Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218916 1046 bp mRNA linear INV 09-DEC-2024 transcript variant X4, mRNA. ACCESSION XM_070218916 VERSION XM_070218916.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1046 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1046 /gene="LOC108065459" /note="trypsin eta; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108065459" CDS 363..992 /gene="LOC108065459" /codon_start=1 /product="trypsin eta isoform X3" /protein_id="XP_070075017.1" /db_xref="GeneID:108065459" /translation="MGSTYLKNSTDLTLEYYLQQLIPHENYNSDSLTNDIALMFINGY IPWNWPTVKALALNSQLVATSTDCLISGWGLLQQNGILSSNTLQSATVPIVSYATCRV SYGTVPTSQVCAGYWTGGVDACQGDSGGPMSCNGKLAGIVSYGAGCAQAGYPGVYTNV SYYNDWIVQKNNSLNYTLYHNAGIRLGSGWSFLGTCLPLILAFVLDLRV" misc_feature <366..872 /gene="LOC108065459" /note="Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. Alignment contains also inactive enzymes that have substitutions of the catalytic triad...; Region: Tryp_SPc; cd00190" /db_xref="CDD:238113" misc_feature order(726..728,789..791,795..797) /gene="LOC108065459" /note="substrate binding sites [chemical binding]; other site" /db_xref="CDD:238113" polyA_site 1046 /gene="LOC108065459" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 caattatcca actaattttc caaggagcgg caatcacaac acattcgatt agattgcttt 61 gtttttccat tccaccaaag agctataaac cgcacaccat ataaaccata taattctgaa 121 atcttgatgc cgagacgacc ggaaagatag agcccaagat cgtgggagga agtgcgacat 181 atatcgaaca ggttccctac caggtgtcca ttcgcctgac cgccaacgat aggaagagct 241 atggttccgg tcacttgtgc ggcggagtgg tgatttccca gcgtctggtg gccaccgccg 301 cccattgtgt ttatattgcc gaacaaaaga aataccgtac tgctggtgag ttcgtactgg 361 tgatgggcag cacctacttg aagaactcca ccgatctgac actggagtac tacctgcagc 421 agctgatccc acatgagaac tacaactcgg actcgttgac caacgacatt gcgctgatgt 481 tcatcaatgg atatattccc tggaattggc caacggtgaa ggccctggca ctaaacagcc 541 aactcgtggc caccagcacc gactgcctga tctctggatg gggtctgctc caacagaacg 601 gaatactaag cagcaatact ctgcagtctg ccacggtgcc cattgtctcc tatgccacct 661 gccgagtttc ctacggcacg gttcccactt cccaggtgtg tgccggatat tggactggag 721 gagtggacgc ctgccagggc gattccggcg gacccatgag ttgcaacgga aagttggccg 781 gcatcgtttc ctacggcgcc ggttgcgcgc aagctggtta tccgggtgtc tacacgaatg 841 tctcgtacta caatgattgg atcgtccaga agaacaactc cttgaactac acgctctatc 901 ataatgcagg aatacggctg ggatcgggtt ggtccttcct cgggacttgt cttccactca 961 tccttgcctt cgtcttggat ctcagagtct aagtgatact ttagtccttg tagctaataa 1021 ataaatcaat ttattctttt tataaa