Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii trypsin eta (LOC108065459),


LOCUS       XM_070218916            1046 bp    mRNA    linear   INV 09-DEC-2024
            transcript variant X4, mRNA.
ACCESSION   XM_070218916
VERSION     XM_070218916.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1046
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1046
                     /gene="LOC108065459"
                     /note="trypsin eta; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 1 Protein"
                     /db_xref="GeneID:108065459"
     CDS             363..992
                     /gene="LOC108065459"
                     /codon_start=1
                     /product="trypsin eta isoform X3"
                     /protein_id="XP_070075017.1"
                     /db_xref="GeneID:108065459"
                     /translation="MGSTYLKNSTDLTLEYYLQQLIPHENYNSDSLTNDIALMFINGY
                     IPWNWPTVKALALNSQLVATSTDCLISGWGLLQQNGILSSNTLQSATVPIVSYATCRV
                     SYGTVPTSQVCAGYWTGGVDACQGDSGGPMSCNGKLAGIVSYGAGCAQAGYPGVYTNV
                     SYYNDWIVQKNNSLNYTLYHNAGIRLGSGWSFLGTCLPLILAFVLDLRV"
     misc_feature    <366..872
                     /gene="LOC108065459"
                     /note="Trypsin-like serine protease; Many of these are
                     synthesized as inactive precursor zymogens that are
                     cleaved during limited proteolysis to generate their
                     active forms. Alignment contains also inactive enzymes
                     that have substitutions of the catalytic triad...; Region:
                     Tryp_SPc; cd00190"
                     /db_xref="CDD:238113"
     misc_feature    order(726..728,789..791,795..797)
                     /gene="LOC108065459"
                     /note="substrate binding sites [chemical binding]; other
                     site"
                     /db_xref="CDD:238113"
     polyA_site      1046
                     /gene="LOC108065459"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 caattatcca actaattttc caaggagcgg caatcacaac acattcgatt agattgcttt
       61 gtttttccat tccaccaaag agctataaac cgcacaccat ataaaccata taattctgaa
      121 atcttgatgc cgagacgacc ggaaagatag agcccaagat cgtgggagga agtgcgacat
      181 atatcgaaca ggttccctac caggtgtcca ttcgcctgac cgccaacgat aggaagagct
      241 atggttccgg tcacttgtgc ggcggagtgg tgatttccca gcgtctggtg gccaccgccg
      301 cccattgtgt ttatattgcc gaacaaaaga aataccgtac tgctggtgag ttcgtactgg
      361 tgatgggcag cacctacttg aagaactcca ccgatctgac actggagtac tacctgcagc
      421 agctgatccc acatgagaac tacaactcgg actcgttgac caacgacatt gcgctgatgt
      481 tcatcaatgg atatattccc tggaattggc caacggtgaa ggccctggca ctaaacagcc
      541 aactcgtggc caccagcacc gactgcctga tctctggatg gggtctgctc caacagaacg
      601 gaatactaag cagcaatact ctgcagtctg ccacggtgcc cattgtctcc tatgccacct
      661 gccgagtttc ctacggcacg gttcccactt cccaggtgtg tgccggatat tggactggag
      721 gagtggacgc ctgccagggc gattccggcg gacccatgag ttgcaacgga aagttggccg
      781 gcatcgtttc ctacggcgcc ggttgcgcgc aagctggtta tccgggtgtc tacacgaatg
      841 tctcgtacta caatgattgg atcgtccaga agaacaactc cttgaactac acgctctatc
      901 ataatgcagg aatacggctg ggatcgggtt ggtccttcct cgggacttgt cttccactca
      961 tccttgcctt cgtcttggat ctcagagtct aagtgatact ttagtccttg tagctaataa
     1021 ataaatcaat ttattctttt tataaa