Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218914 1181 bp mRNA linear INV 09-DEC-2024 transcript variant X2, mRNA. ACCESSION XM_070218914 VERSION XM_070218914.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1181 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1181 /gene="LOC108065459" /note="trypsin eta; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108065459" CDS 231..1127 /gene="LOC108065459" /codon_start=1 /product="trypsin eta isoform X2" /protein_id="XP_070075015.1" /db_xref="GeneID:108065459" /translation="MVMPMTDIYLDAETTGKIEPKIVGGSATYIEQVPYQVSIRLTAN DRKSYGSGHLCGGVVISQRLVATAAHCVYIAEQKKYRTAGEFVLVMGSTYLKNSTDLT LEYYLQQLIPHENYNSDSLTNDIALMFINGYIPWNWPTVKALALNSQLVATSTDCLIS GWGLLQQNGILSSNTLQSATVPIVSYATCRVSYGTVPTSQVCAGYWTGGVDACQGDSG GPMSCNGKLAGIVSYGAGCAQAGYPGVYTNVSYYNDWIVQKNNSLNYTLYHNAGIRLG SGWSFLGTCLPLILAFVLDLRV" misc_feature 291..998 /gene="LOC108065459" /note="Trypsin-like serine protease; Region: Tryp_SPc; smart00020" /db_xref="CDD:214473" misc_feature 294..296 /gene="LOC108065459" /note="cleavage site [active]" /db_xref="CDD:238113" misc_feature order(438..440,600..602,879..881) /gene="LOC108065459" /note="active site" /db_xref="CDD:238113" misc_feature order(861..863,924..926,930..932) /gene="LOC108065459" /note="substrate binding sites [chemical binding]; other site" /db_xref="CDD:238113" polyA_site 1181 /gene="LOC108065459" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ctaattttcc aaggagcggc aatcacaaca cattcgatta gattgctttg tttttccatt 61 ccaccaaaga gctataaacc gcacaccata taaaccatat aattctgaag tactttcttg 121 ttaagacaac aattccagcc cggctatctc ttagccaccg ataaacagca attgttcaaa 181 tacgtattca atgcagttag ttgtcaagga ggtgtatcag atggcattgg atggtcatgc 241 ccatgaccga tatatatctt gatgccgaga cgaccggaaa gatagagccc aagatcgtgg 301 gaggaagtgc gacatatatc gaacaggttc cctaccaggt gtccattcgc ctgaccgcca 361 acgataggaa gagctatggt tccggtcact tgtgcggcgg agtggtgatt tcccagcgtc 421 tggtggccac cgccgcccat tgtgtttata ttgccgaaca aaagaaatac cgtactgctg 481 gtgagttcgt actggtgatg ggcagcacct acttgaagaa ctccaccgat ctgacactgg 541 agtactacct gcagcagctg atcccacatg agaactacaa ctcggactcg ttgaccaacg 601 acattgcgct gatgttcatc aatggatata ttccctggaa ttggccaacg gtgaaggccc 661 tggcactaaa cagccaactc gtggccacca gcaccgactg cctgatctct ggatggggtc 721 tgctccaaca gaacggaata ctaagcagca atactctgca gtctgccacg gtgcccattg 781 tctcctatgc cacctgccga gtttcctacg gcacggttcc cacttcccag gtgtgtgccg 841 gatattggac tggaggagtg gacgcctgcc agggcgattc cggcggaccc atgagttgca 901 acggaaagtt ggccggcatc gtttcctacg gcgccggttg cgcgcaagct ggttatccgg 961 gtgtctacac gaatgtctcg tactacaatg attggatcgt ccagaagaac aactccttga 1021 actacacgct ctatcataat gcaggaatac ggctgggatc gggttggtcc ttcctcggga 1081 cttgtcttcc actcatcctt gccttcgtct tggatctcag agtctaagtg atactttagt 1141 ccttgtagct aataaataaa tcaatttatt ctttttataa a