Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218911 1048 bp mRNA linear INV 09-DEC-2024 transcript variant X2, mRNA. ACCESSION XM_070218911 VERSION XM_070218911.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1048 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1048 /gene="Atg5" /note="autophagy protein 5; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:108060328" CDS 115..849 /gene="Atg5" /codon_start=1 /product="autophagy protein 5 isoform X2" /protein_id="XP_070075012.1" /db_xref="GeneID:108060328" /translation="MAHDREVLRMIWEGQIGICFTADRDEIVGIKPEPFYLMISRLSY LPLVTDKVRKYFSRYISAEHQDGAVWFDFNGTPLRLHYPIGVLYDLLHPEEDSTPWCL TIHFSKFPEGTLVKLNSKELLESHYMSCLKEADVLKHRGLVISAMQKKDHNQLWLGLV NDKFDQFWAVNRRLMEPYAEQESFKHIPLRIYTDDDFTYTQKLISPISEGGQKKSLAD LMAELSTPVRKAEFSAVYSSICCWRF" misc_feature 355..>783 /gene="Atg5" /note="Autophagy protein Apg5; Region: APG5; pfam04106" /db_xref="CDD:461175" ORIGIN 1 cacacaaatt ggacacccct gggatctatc gataacaacc ccgttttacc aagtgcaaaa 61 agtaaaaata taattttaat caaaacaaaa gcgaattttt cggaattttg gagcatggcc 121 cacgaccgcg aggtgttgcg aatgatctgg gagggccaga taggcatctg cttcacggcg 181 gatcgggacg agatagtggg tataaagccg gagcccttct atctcatgat atcgcgactg 241 agttacttgc ccttggtcac cgataaggtt cgcaagtact tctcccggta tataagcgcc 301 gaacaccagg atggagccgt ttggttcgat ttcaatggca cgcccctgcg ccttcactat 361 ccaattggtg tcctgtacga tctgctgcat cccgaggaag acagcacgcc ctggtgcctc 421 accatccact tctccaagtt ccccgagggc acgctcgtca agctgaattc caaggagctt 481 ctggagtcgc actacatgtc ctgcctgaag gaggcggatg tgctgaagca ccgcggcctc 541 gtgatttccg cgatgcagaa gaaggatcac aatcaattgt ggctgggcct cgtcaacgac 601 aagttcgatc agttctgggc ggtaaatcgc aggctaatgg agccgtatgc cgaacaggag 661 tccttcaagc acattcccct gcgaatctac acggacgatg actttacgta cacccagaaa 721 ctgatttcgc cgatcagcga gggcggacaa aagaagagtc tggccgacct gatggccgaa 781 ttatcgacac ctgtgcgcaa agcggaattt tctgcagtgt attcttcgat ttgttgctgg 841 cggttttgac gaactgaacg cgctgcttgg gaggtgttac cctatagaga atgcacaaac 901 acacatccac tcgcaatgaa ccccagaaat acacacacca ctcgatgtgg agtgtgtgtg 961 cgagtgaggt gtgccggtgt gagtgcagtg tgcattgcat cgccagaccg tccggcgcgc 1021 ataacgtcat cggcatttgg aacagcga