Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii autophagy protein 5 (Atg5),


LOCUS       XM_070218911            1048 bp    mRNA    linear   INV 09-DEC-2024
            transcript variant X2, mRNA.
ACCESSION   XM_070218911
VERSION     XM_070218911.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1048
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1048
                     /gene="Atg5"
                     /note="autophagy protein 5; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 7
                     Proteins"
                     /db_xref="GeneID:108060328"
     CDS             115..849
                     /gene="Atg5"
                     /codon_start=1
                     /product="autophagy protein 5 isoform X2"
                     /protein_id="XP_070075012.1"
                     /db_xref="GeneID:108060328"
                     /translation="MAHDREVLRMIWEGQIGICFTADRDEIVGIKPEPFYLMISRLSY
                     LPLVTDKVRKYFSRYISAEHQDGAVWFDFNGTPLRLHYPIGVLYDLLHPEEDSTPWCL
                     TIHFSKFPEGTLVKLNSKELLESHYMSCLKEADVLKHRGLVISAMQKKDHNQLWLGLV
                     NDKFDQFWAVNRRLMEPYAEQESFKHIPLRIYTDDDFTYTQKLISPISEGGQKKSLAD
                     LMAELSTPVRKAEFSAVYSSICCWRF"
     misc_feature    355..>783
                     /gene="Atg5"
                     /note="Autophagy protein Apg5; Region: APG5; pfam04106"
                     /db_xref="CDD:461175"
ORIGIN      
        1 cacacaaatt ggacacccct gggatctatc gataacaacc ccgttttacc aagtgcaaaa
       61 agtaaaaata taattttaat caaaacaaaa gcgaattttt cggaattttg gagcatggcc
      121 cacgaccgcg aggtgttgcg aatgatctgg gagggccaga taggcatctg cttcacggcg
      181 gatcgggacg agatagtggg tataaagccg gagcccttct atctcatgat atcgcgactg
      241 agttacttgc ccttggtcac cgataaggtt cgcaagtact tctcccggta tataagcgcc
      301 gaacaccagg atggagccgt ttggttcgat ttcaatggca cgcccctgcg ccttcactat
      361 ccaattggtg tcctgtacga tctgctgcat cccgaggaag acagcacgcc ctggtgcctc
      421 accatccact tctccaagtt ccccgagggc acgctcgtca agctgaattc caaggagctt
      481 ctggagtcgc actacatgtc ctgcctgaag gaggcggatg tgctgaagca ccgcggcctc
      541 gtgatttccg cgatgcagaa gaaggatcac aatcaattgt ggctgggcct cgtcaacgac
      601 aagttcgatc agttctgggc ggtaaatcgc aggctaatgg agccgtatgc cgaacaggag
      661 tccttcaagc acattcccct gcgaatctac acggacgatg actttacgta cacccagaaa
      721 ctgatttcgc cgatcagcga gggcggacaa aagaagagtc tggccgacct gatggccgaa
      781 ttatcgacac ctgtgcgcaa agcggaattt tctgcagtgt attcttcgat ttgttgctgg
      841 cggttttgac gaactgaacg cgctgcttgg gaggtgttac cctatagaga atgcacaaac
      901 acacatccac tcgcaatgaa ccccagaaat acacacacca ctcgatgtgg agtgtgtgtg
      961 cgagtgaggt gtgccggtgt gagtgcagtg tgcattgcat cgccagaccg tccggcgcgc
     1021 ataacgtcat cggcatttgg aacagcga