Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_070218850             868 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108062297), transcript variant X1, mRNA.
ACCESSION   XM_070218850
VERSION     XM_070218850.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..868
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..868
                     /gene="LOC108062297"
                     /note="uncharacterized LOC108062297; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108062297"
     CDS             317..730
                     /gene="LOC108062297"
                     /codon_start=1
                     /product="uncharacterized protein isoform X1"
                     /protein_id="XP_070074951.1"
                     /db_xref="GeneID:108062297"
                     /translation="MSHGERKGRLNVVKFLELGFAVACLVLHFYSFNDRDIMTSFLAT
                     GTFTGYIIVVIGVFADIVKIPGVLMRAPIHKRIDIFFSVLGCTLFVASGVFIIEAWEF
                     SFRTRTRDLALIKASLSIVNGVLFGFDAVFTFRDK"
ORIGIN      
        1 aaacccagac ggtgtccact tcacagacgg acccgagagg ccccgagaat agcaaacgtg
       61 aacggatgaa aagcctattt cctaagtgta attaattaat ttcggtggct gtgacggtga
      121 ctgcgcccaa ctgcaagcag cagttgcctg ctgcatccga catctccgac atccattcga
      181 ttcagtttat ccagcgcact gtcgtcgcga acacgtccag aataactcga aaaaatctgt
      241 tttcgtatta cggaatttac ggattatcaa actggatcac attttcgagg acggtcagcg
      301 gcagcagttt cacaaaatgt cccacggcga gcgaaaaggc cgcctgaatg tggtcaagtt
      361 tctggaattg ggctttgcgg tagcgtgtct agtgcttcac ttctacagct ttaatgatcg
      421 cgatattatg acctcgtttt tggccactgg cacctttacg ggctacatca tagtggtgat
      481 cggggtattt gcagatatcg tcaaaattcc aggtgttctg atgcgggccc ccattcacaa
      541 gcgcatcgac attttcttca gtgtcctggg ctgcactctg ttcgtggcca gcggcgtgtt
      601 catcatcgag gcctgggagt tctcgttccg caccagaact cgggatctcg cgctcatcaa
      661 ggcctcgttg tccatcgtca atggggtgct gttcggattc gatgccgtct tcacatttcg
      721 cgacaagtga atcatcgctt tttttgagcc actggacacc attttgccaa atcctctgga
      781 gcttcttttt tgtgcattta atagttgtaa gaatatatat atattttttt cgtcgcccta
      841 aattgtactt ccactagacc ttaaaaac