Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218850 868 bp mRNA linear INV 09-DEC-2024 (LOC108062297), transcript variant X1, mRNA. ACCESSION XM_070218850 VERSION XM_070218850.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..868 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..868 /gene="LOC108062297" /note="uncharacterized LOC108062297; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108062297" CDS 317..730 /gene="LOC108062297" /codon_start=1 /product="uncharacterized protein isoform X1" /protein_id="XP_070074951.1" /db_xref="GeneID:108062297" /translation="MSHGERKGRLNVVKFLELGFAVACLVLHFYSFNDRDIMTSFLAT GTFTGYIIVVIGVFADIVKIPGVLMRAPIHKRIDIFFSVLGCTLFVASGVFIIEAWEF SFRTRTRDLALIKASLSIVNGVLFGFDAVFTFRDK" ORIGIN 1 aaacccagac ggtgtccact tcacagacgg acccgagagg ccccgagaat agcaaacgtg 61 aacggatgaa aagcctattt cctaagtgta attaattaat ttcggtggct gtgacggtga 121 ctgcgcccaa ctgcaagcag cagttgcctg ctgcatccga catctccgac atccattcga 181 ttcagtttat ccagcgcact gtcgtcgcga acacgtccag aataactcga aaaaatctgt 241 tttcgtatta cggaatttac ggattatcaa actggatcac attttcgagg acggtcagcg 301 gcagcagttt cacaaaatgt cccacggcga gcgaaaaggc cgcctgaatg tggtcaagtt 361 tctggaattg ggctttgcgg tagcgtgtct agtgcttcac ttctacagct ttaatgatcg 421 cgatattatg acctcgtttt tggccactgg cacctttacg ggctacatca tagtggtgat 481 cggggtattt gcagatatcg tcaaaattcc aggtgttctg atgcgggccc ccattcacaa 541 gcgcatcgac attttcttca gtgtcctggg ctgcactctg ttcgtggcca gcggcgtgtt 601 catcatcgag gcctgggagt tctcgttccg caccagaact cgggatctcg cgctcatcaa 661 ggcctcgttg tccatcgtca atggggtgct gttcggattc gatgccgtct tcacatttcg 721 cgacaagtga atcatcgctt tttttgagcc actggacacc attttgccaa atcctctgga 781 gcttcttttt tgtgcattta atagttgtaa gaatatatat atattttttt cgtcgcccta 841 aattgtactt ccactagacc ttaaaaac