Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii microsomal glutathione


LOCUS       XM_070218849             853 bp    mRNA    linear   INV 09-DEC-2024
            S-transferase 1 (LOC108054263), transcript variant X1, mRNA.
ACCESSION   XM_070218849
VERSION     XM_070218849.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..853
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..853
                     /gene="LOC108054263"
                     /note="microsomal glutathione S-transferase 1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 4 Proteins"
                     /db_xref="GeneID:108054263"
     CDS             301..825
                     /gene="LOC108054263"
                     /codon_start=1
                     /product="microsomal glutathione S-transferase 1 isoform
                     X1"
                     /protein_id="XP_070074950.1"
                     /db_xref="GeneID:108054263"
                     /translation="MSSPQSSNNTTTGDMFTLENRVFCCYLFWATVLVAKMLLMSLLT
                     AVQRFRYKLLAFVPLVVRRKVFPNQEDLFFKNLEVQFNDPNVERVRRAHRNDMENILP
                     YFIMSLIYISTNPNAVVACNLFRVASVARIIHTLVYAVYPVPQPSRILAFATMLLITF
                     YMAAVVALRTLSFI"
     misc_feature    376..804
                     /gene="LOC108054263"
                     /note="MAPEG family; Region: MAPEG; pfam01124"
                     /db_xref="CDD:460074"
     polyA_site      853
                     /gene="LOC108054263"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attttttttt taactaatta tttattacaa atcatataaa ttcgaaattt aaggattttt
       61 ttctctatat agaggtagtt tgaaataata gtgtaccaca gcttagctac cccgaaatgg
      121 gtaaaataga gttattgctg cacagcacct tggatattcg gttcgacgca attcgtaacc
      181 agtttggtcg catgtctatg atctccgcat tgagtgctga ttgctgagtg ctgctgcgag
      241 ttaatcattc ggcgaagtcg cctcaaagtg aacgcacata cagcacattc cgcatccgcc
      301 atgtcgtccc cacaaagttc aaataatacg accaccggcg atatgttcac cctggagaat
      361 cgcgtctttt gctgctacct cttttgggcc actgtgctgg tggccaagat gctgctcatg
      421 tcgctgctga cggccgtcca gcgtttccgc tataagctgc tggcattcgt accgctggtt
      481 gtgcggcgca aggtctttcc caaccaggag gatctgttct tcaagaacct cgaggtgcaa
      541 ttcaatgatc cgaatgtgga gcgggttaga agagcccatc gcaatgacat ggagaacatc
      601 ctgccgtact tcatcatgtc cctgatctac atcagcacca atccgaatgc cgttgtggcc
      661 tgcaatctgt tccgagtggc ctccgtggcc aggatcatcc acaccctggt ctacgccgtc
      721 tatccggtgc cgcagccttc gaggatcctg gccttcgcca ccatgctcct gatcaccttc
      781 tacatggccg ccgtggtggc cctgcgcacc cttagcttta tctaaataaa ctgtagtgac
      841 tatcggctta aaa