Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_070218848             945 bp    mRNA    linear   INV 09-DEC-2024
            (LOC138913842), mRNA.
ACCESSION   XM_070218848
VERSION     XM_070218848.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..945
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..945
                     /gene="LOC138913842"
                     /note="uncharacterized LOC138913842; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:138913842"
     CDS             378..890
                     /gene="LOC138913842"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_070074949.1"
                     /db_xref="GeneID:138913842"
                     /translation="MISSSIDQLLADQLELGERIQSIIRNYKKDSRKRKSKPGYFKDR
                     LTKLELLWDTFFTAANQIQTAIQGMPVEHKYFENNVFMETENSIIEWKAEFNKNPNVL
                     ENDTTPGSPIKGDNKLESIPRDQKVLLDRMDILMNQIIADSKRGVKRVTLPYWSEMKN
                     MHEQICKNYN"
ORIGIN      
        1 aattaaattg aacttgatct gaaaacgtga gttgtgttga gttggagaat catcgatagc
       61 agcgatagca tcgatagcca tcgacgatgc cccatccctg ggcatcggtg gtgatggtgg
      121 tgtgaccagg ctactagact ttaagcttaa acaattggcg gcctgtcgtt ctgggatttc
      181 ctaggaattt cctggaaaac catagcattt tccaaactag agaacttacc taagaagatc
      241 acctggcacc gtcataaaag gcatctcagt acctacctat aagaaaatat atataaaccc
      301 cgaaggaaac tcctcctatt cagtgcgaaa gcgacctttg attgcttcag tttgttattt
      361 gtattaccat atcaaaaatg atctcttcga gcattgatca actgctggcc gatcaactgg
      421 aattgggcga acgcattcag agcatcattc gaaactataa aaaggattcc aggaagcgaa
      481 aatcgaagcc tggctacttt aaggatcgcc taactaaact ggaacttctg tgggacactt
      541 ttttcacagc agcaaatcaa attcaaacgg ccattcaggg gatgccagtt gaacataaat
      601 attttgagaa caacgtcttt atggaaacag agaactcgat catcgaatgg aaagcagaat
      661 tcaacaaaaa cccgaatgta ttagaaaacg acaccactcc cggttcacca ataaaaggag
      721 ataataaact ggaaagtatt ccaagagatc aaaaagtgtt gctggacaga atggatattc
      781 taatgaatca aattattgcc gactcaaagc gaggtgtaaa acgcgtcacc ctaccatatt
      841 ggagtgagat gaaaaatatg cacgagcaaa tctgtaagaa ctacaactaa ctacaaaaac
      901 tgatattact attatgttat gtatatttat taagtaaaat atata