Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218848 945 bp mRNA linear INV 09-DEC-2024 (LOC138913842), mRNA. ACCESSION XM_070218848 VERSION XM_070218848.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..945 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..945 /gene="LOC138913842" /note="uncharacterized LOC138913842; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:138913842" CDS 378..890 /gene="LOC138913842" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_070074949.1" /db_xref="GeneID:138913842" /translation="MISSSIDQLLADQLELGERIQSIIRNYKKDSRKRKSKPGYFKDR LTKLELLWDTFFTAANQIQTAIQGMPVEHKYFENNVFMETENSIIEWKAEFNKNPNVL ENDTTPGSPIKGDNKLESIPRDQKVLLDRMDILMNQIIADSKRGVKRVTLPYWSEMKN MHEQICKNYN" ORIGIN 1 aattaaattg aacttgatct gaaaacgtga gttgtgttga gttggagaat catcgatagc 61 agcgatagca tcgatagcca tcgacgatgc cccatccctg ggcatcggtg gtgatggtgg 121 tgtgaccagg ctactagact ttaagcttaa acaattggcg gcctgtcgtt ctgggatttc 181 ctaggaattt cctggaaaac catagcattt tccaaactag agaacttacc taagaagatc 241 acctggcacc gtcataaaag gcatctcagt acctacctat aagaaaatat atataaaccc 301 cgaaggaaac tcctcctatt cagtgcgaaa gcgacctttg attgcttcag tttgttattt 361 gtattaccat atcaaaaatg atctcttcga gcattgatca actgctggcc gatcaactgg 421 aattgggcga acgcattcag agcatcattc gaaactataa aaaggattcc aggaagcgaa 481 aatcgaagcc tggctacttt aaggatcgcc taactaaact ggaacttctg tgggacactt 541 ttttcacagc agcaaatcaa attcaaacgg ccattcaggg gatgccagtt gaacataaat 601 attttgagaa caacgtcttt atggaaacag agaactcgat catcgaatgg aaagcagaat 661 tcaacaaaaa cccgaatgta ttagaaaacg acaccactcc cggttcacca ataaaaggag 721 ataataaact ggaaagtatt ccaagagatc aaaaagtgtt gctggacaga atggatattc 781 taatgaatca aattattgcc gactcaaagc gaggtgtaaa acgcgtcacc ctaccatatt 841 ggagtgagat gaaaaatatg cacgagcaaa tctgtaagaa ctacaactaa ctacaaaaac 901 tgatattact attatgttat gtatatttat taagtaaaat atata