Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218817 999 bp mRNA linear INV 09-DEC-2024 (LOC108064251), transcript variant X2, mRNA. ACCESSION XM_070218817 VERSION XM_070218817.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..999 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..999 /gene="LOC108064251" /note="uncharacterized LOC108064251; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:108064251" CDS 160..750 /gene="LOC108064251" /codon_start=1 /product="uncharacterized protein isoform X2" /protein_id="XP_070074918.1" /db_xref="GeneID:108064251" /translation="MLLEGLSHYNRPLEIKFDEMLKLMDQCEHVDKLSYASRHKSKLE GNERSSGGGAGDASSTGGANDGVALKLATNIFPRSPFSLLSGIIPGTKWCGTGDIAET YSDLGSEMAMDRCCRQHDLCPIKIRAYQHKYELMNDSLYTKSHCICDDMLFSCLKMTN TSASQLMGSIYFNLVQVPCLDGRSDQYKFRAAKEGF" misc_feature 418..702 /gene="LOC108064251" /note="A sub-family of Phospholipase A2, similar to bee venom PLA2. PLA2 is a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. Enzymatically active PLA2 cleaves the sn-2 position of the glycerol backbone of...; Region: PLA2_bee_venom_like; cd04704" /db_xref="CDD:153093" misc_feature order(436..438,442..444,448..450,517..519) /gene="LOC108064251" /note="metal binding site [ion binding]; metal-binding site" /db_xref="CDD:153093" misc_feature order(514..516,604..606,670..672) /gene="LOC108064251" /note="catalytic site [active]" /db_xref="CDD:153093" polyA_site 999 /gene="LOC108064251" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gtttataaaa attgagtatg ttatactcgt ataaatataa aagttttgga aaattaaaaa 61 ttatttttat ttgtaaaatc attttaattt aatacttgta ttgctaataa agaagaatga 121 ggcgtgcctt cagctacgaa caacgataag gagggcaaga tgctgctgga gggcctctcg 181 cactataatc gccccctgga aattaaattc gacgagatgc ttaagctgat ggatcagtgc 241 gagcatgtgg acaagctgag ctacgcctcg cgtcacaaat ccaaactgga gggcaatgag 301 cgtagcagtg gcggcggagc tggcgatgca tcctcaacgg gcggagccaa cgatggagtc 361 gccctcaagc tggccaccaa tatctttccg cgcagtccct tctccctgct gagtggcatt 421 attccaggca caaaatggtg tggcactggc gatatcgcag agacatacag cgatctgggt 481 agcgaaatgg ccatggatcg atgctgtcgc caacacgatc tgtgtcccat taagatccga 541 gcctatcagc acaaatacga actgatgaac gattcgctgt acacaaagtc ccattgcatc 601 tgcgacgaca tgctgttctc ctgcctgaag atgaccaaca cctcggcctc gcagctgatg 661 ggctccatct acttcaacct ggtgcaggtg ccctgtctgg acggacggag cgatcagtac 721 aaattccggg cggccaagga gggattctaa gcgggggaga gacccgaaaa ttcagggggt 781 ttcactgtac aggaggtggg gaggcaagat gaagaggagg ggaaatcgct ctatttattg 841 ttttacaaat gatgacgccc gctttttatt tatcgaatat tctgttgggt ttacagttta 901 cggtttacat ttagcgttaa cgttatctag gataagtata atgtagaatc ttgcaatctt 961 tgttatacaa atacgaatat aaatataaat atatatata