Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_070218817             999 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108064251), transcript variant X2, mRNA.
ACCESSION   XM_070218817
VERSION     XM_070218817.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..999
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..999
                     /gene="LOC108064251"
                     /note="uncharacterized LOC108064251; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:108064251"
     CDS             160..750
                     /gene="LOC108064251"
                     /codon_start=1
                     /product="uncharacterized protein isoform X2"
                     /protein_id="XP_070074918.1"
                     /db_xref="GeneID:108064251"
                     /translation="MLLEGLSHYNRPLEIKFDEMLKLMDQCEHVDKLSYASRHKSKLE
                     GNERSSGGGAGDASSTGGANDGVALKLATNIFPRSPFSLLSGIIPGTKWCGTGDIAET
                     YSDLGSEMAMDRCCRQHDLCPIKIRAYQHKYELMNDSLYTKSHCICDDMLFSCLKMTN
                     TSASQLMGSIYFNLVQVPCLDGRSDQYKFRAAKEGF"
     misc_feature    418..702
                     /gene="LOC108064251"
                     /note="A sub-family of Phospholipase A2, similar to bee
                     venom PLA2. PLA2 is a super-family of secretory and
                     cytosolic enzymes; the latter are either Ca dependent or
                     Ca independent. Enzymatically active PLA2 cleaves the sn-2
                     position of the glycerol backbone of...; Region:
                     PLA2_bee_venom_like; cd04704"
                     /db_xref="CDD:153093"
     misc_feature    order(436..438,442..444,448..450,517..519)
                     /gene="LOC108064251"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:153093"
     misc_feature    order(514..516,604..606,670..672)
                     /gene="LOC108064251"
                     /note="catalytic site [active]"
                     /db_xref="CDD:153093"
     polyA_site      999
                     /gene="LOC108064251"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtttataaaa attgagtatg ttatactcgt ataaatataa aagttttgga aaattaaaaa
       61 ttatttttat ttgtaaaatc attttaattt aatacttgta ttgctaataa agaagaatga
      121 ggcgtgcctt cagctacgaa caacgataag gagggcaaga tgctgctgga gggcctctcg
      181 cactataatc gccccctgga aattaaattc gacgagatgc ttaagctgat ggatcagtgc
      241 gagcatgtgg acaagctgag ctacgcctcg cgtcacaaat ccaaactgga gggcaatgag
      301 cgtagcagtg gcggcggagc tggcgatgca tcctcaacgg gcggagccaa cgatggagtc
      361 gccctcaagc tggccaccaa tatctttccg cgcagtccct tctccctgct gagtggcatt
      421 attccaggca caaaatggtg tggcactggc gatatcgcag agacatacag cgatctgggt
      481 agcgaaatgg ccatggatcg atgctgtcgc caacacgatc tgtgtcccat taagatccga
      541 gcctatcagc acaaatacga actgatgaac gattcgctgt acacaaagtc ccattgcatc
      601 tgcgacgaca tgctgttctc ctgcctgaag atgaccaaca cctcggcctc gcagctgatg
      661 ggctccatct acttcaacct ggtgcaggtg ccctgtctgg acggacggag cgatcagtac
      721 aaattccggg cggccaagga gggattctaa gcgggggaga gacccgaaaa ttcagggggt
      781 ttcactgtac aggaggtggg gaggcaagat gaagaggagg ggaaatcgct ctatttattg
      841 ttttacaaat gatgacgccc gctttttatt tatcgaatat tctgttgggt ttacagttta
      901 cggtttacat ttagcgttaa cgttatctag gataagtata atgtagaatc ttgcaatctt
      961 tgttatacaa atacgaatat aaatataaat atatatata