Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218815 671 bp mRNA linear INV 09-DEC-2024 (LOC138913836), transcript variant X4, mRNA. ACCESSION XM_070218815 VERSION XM_070218815.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..671 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..671 /gene="LOC138913836" /note="uncharacterized LOC138913836; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:138913836" CDS 287..484 /gene="LOC138913836" /codon_start=1 /product="uncharacterized protein isoform X4" /protein_id="XP_070074916.1" /db_xref="GeneID:138913836" /translation="MMLWLMGLCLKFISSGIEKWDTTKDLYGKIMTKLGVAYGIVSEV YQFQDRKAGHVALSAFQMWEP" ORIGIN 1 tatgcaaaag aagaacaaaa agctctctat aaaattaaat agccgtatgg gttcgaggcg 61 tctttttaca tgctgtgaaa catgggaaaa caggtcgtaa agtcggtcta aaaactctaa 121 aaactagaaa cttcgaaata aaagtgccag taaacgatat gtgcacggtt tctgtcgtcg 181 taaaaaacag cgagtgacgt acagaatttt cacactcgca aatcgtgccc ttggccctcg 241 agtcgagtta aagctaaatc taaaaccaaa gctgaagcga aagattatga tgctatggtt 301 aatgggattg tgtctgaagt tcatcagttc cgggatcgaa aagtgggata cgactaaaga 361 tctatatggc aagattatga ctaaactagg ggtagcttat gggattgttt ctgaagttta 421 tcagtttcag gatcgaaaag cgggacacgt cgctttatca gcatttcaaa tgtgggaacc 481 atagacggac cccgccccct gccttccgcc ttcgctgggc gtggcgacag tgggacgcca 541 aaacaaattc tgggccaaaa caaatttctc aaagcgcaac agttgacaac ttagttacac 601 ggaaaaaata tatatttaat gcgacttaag aaaatgagat gtaaaatgta taaatgttaa 661 taaatccaat a