Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_070218815             671 bp    mRNA    linear   INV 09-DEC-2024
            (LOC138913836), transcript variant X4, mRNA.
ACCESSION   XM_070218815
VERSION     XM_070218815.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..671
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..671
                     /gene="LOC138913836"
                     /note="uncharacterized LOC138913836; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:138913836"
     CDS             287..484
                     /gene="LOC138913836"
                     /codon_start=1
                     /product="uncharacterized protein isoform X4"
                     /protein_id="XP_070074916.1"
                     /db_xref="GeneID:138913836"
                     /translation="MMLWLMGLCLKFISSGIEKWDTTKDLYGKIMTKLGVAYGIVSEV
                     YQFQDRKAGHVALSAFQMWEP"
ORIGIN      
        1 tatgcaaaag aagaacaaaa agctctctat aaaattaaat agccgtatgg gttcgaggcg
       61 tctttttaca tgctgtgaaa catgggaaaa caggtcgtaa agtcggtcta aaaactctaa
      121 aaactagaaa cttcgaaata aaagtgccag taaacgatat gtgcacggtt tctgtcgtcg
      181 taaaaaacag cgagtgacgt acagaatttt cacactcgca aatcgtgccc ttggccctcg
      241 agtcgagtta aagctaaatc taaaaccaaa gctgaagcga aagattatga tgctatggtt
      301 aatgggattg tgtctgaagt tcatcagttc cgggatcgaa aagtgggata cgactaaaga
      361 tctatatggc aagattatga ctaaactagg ggtagcttat gggattgttt ctgaagttta
      421 tcagtttcag gatcgaaaag cgggacacgt cgctttatca gcatttcaaa tgtgggaacc
      481 atagacggac cccgccccct gccttccgcc ttcgctgggc gtggcgacag tgggacgcca
      541 aaacaaattc tgggccaaaa caaatttctc aaagcgcaac agttgacaac ttagttacac
      601 ggaaaaaata tatatttaat gcgacttaag aaaatgagat gtaaaatgta taaatgttaa
      661 taaatccaat a