Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_070218814             594 bp    mRNA    linear   INV 09-DEC-2024
            (LOC138913836), transcript variant X3, mRNA.
ACCESSION   XM_070218814
VERSION     XM_070218814.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..594
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..594
                     /gene="LOC138913836"
                     /note="uncharacterized LOC138913836; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:138913836"
     CDS             290..517
                     /gene="LOC138913836"
                     /codon_start=1
                     /product="uncharacterized protein isoform X3"
                     /protein_id="XP_070074915.1"
                     /db_xref="GeneID:138913836"
                     /translation="MVNGIVSEVHQFRDRKVGYGDFPVASLGRFISISNVGTIDGPRP
                     LPSAFAGRGDSGTPKQILGQNKFLKAQQLTT"
ORIGIN      
        1 aaaagaagaa caaaaagctc tctataaaat taaatagccg tatgggttcg aggcgtcttt
       61 ttacatgctg tgaaacatgg gaaaacaggt cgtaaagtcg gtctaaaaac tctaaaaact
      121 agaaacttcg aaataaaagt gccagtaaac gatatgtgca cggtttctgt cgtcgtaaaa
      181 aacagcgagt gacgtacaga attttcacac tcgcaaatcg tgcccttggc cctcgagtcg
      241 agttaaagct aaatctaaaa ccaaagctga agcgaaagat tatgatgcta tggttaatgg
      301 gattgtgtct gaagttcatc agttccggga tcgaaaagtg ggatacggtg attttccagt
      361 tgcatccctg ggtcgcttta tcagcatttc aaatgtggga accatagacg gaccccgccc
      421 cctgccttcc gccttcgctg ggcgtggcga cagtgggacg ccaaaacaaa ttctgggcca
      481 aaacaaattt ctcaaagcgc aacagttgac aacttagtta cacggaaaaa atatatattt
      541 aatgcgactt aagaaaatga gatgtaaaat gtataaatgt taataaatcc aata