Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218814 594 bp mRNA linear INV 09-DEC-2024 (LOC138913836), transcript variant X3, mRNA. ACCESSION XM_070218814 VERSION XM_070218814.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..594 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..594 /gene="LOC138913836" /note="uncharacterized LOC138913836; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:138913836" CDS 290..517 /gene="LOC138913836" /codon_start=1 /product="uncharacterized protein isoform X3" /protein_id="XP_070074915.1" /db_xref="GeneID:138913836" /translation="MVNGIVSEVHQFRDRKVGYGDFPVASLGRFISISNVGTIDGPRP LPSAFAGRGDSGTPKQILGQNKFLKAQQLTT" ORIGIN 1 aaaagaagaa caaaaagctc tctataaaat taaatagccg tatgggttcg aggcgtcttt 61 ttacatgctg tgaaacatgg gaaaacaggt cgtaaagtcg gtctaaaaac tctaaaaact 121 agaaacttcg aaataaaagt gccagtaaac gatatgtgca cggtttctgt cgtcgtaaaa 181 aacagcgagt gacgtacaga attttcacac tcgcaaatcg tgcccttggc cctcgagtcg 241 agttaaagct aaatctaaaa ccaaagctga agcgaaagat tatgatgcta tggttaatgg 301 gattgtgtct gaagttcatc agttccggga tcgaaaagtg ggatacggtg attttccagt 361 tgcatccctg ggtcgcttta tcagcatttc aaatgtggga accatagacg gaccccgccc 421 cctgccttcc gccttcgctg ggcgtggcga cagtgggacg ccaaaacaaa ttctgggcca 481 aaacaaattt ctcaaagcgc aacagttgac aacttagtta cacggaaaaa atatatattt 541 aatgcgactt aagaaaatga gatgtaaaat gtataaatgt taataaatcc aata