Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218813 726 bp mRNA linear INV 09-DEC-2024 (LOC138913836), transcript variant X2, mRNA. ACCESSION XM_070218813 VERSION XM_070218813.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..726 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..726 /gene="LOC138913836" /note="uncharacterized LOC138913836; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:138913836" CDS 300..539 /gene="LOC138913836" /codon_start=1 /product="uncharacterized protein isoform X2" /protein_id="XP_070074914.1" /db_xref="GeneID:138913836" /translation="MMLWLMGLCLKFISSGIEKWDTTKDLYGKIMTKLGVAYGIVSEV YQFQDRKAGHGDFPVASLGFLFVSVALSAFQMWEP" ORIGIN 1 aggctcctct aaatatgcaa aagaagaaca aaaagctctc tataaaatta aatagccgta 61 tgggttcgag gcgtcttttt acatgctgtg aaacatggga aaacaggtcg taaagtcggt 121 ctaaaaactc taaaaactag aaacttcgaa ataaaagtgc cagtaaacga tatgtgcacg 181 gtttctgtcg tcgtaaaaaa cagcgagtga cgtacagaat tttcacactc gcaaatcgtg 241 cccttggccc tcgagtcgag ttaaagctaa atctaaaacc aaagctgaag cgaaagatta 301 tgatgctatg gttaatggga ttgtgtctga agttcatcag ttccgggatc gaaaagtggg 361 atacgactaa agatctatat ggcaagatta tgactaaact aggggtagct tatgggattg 421 tttctgaagt ttatcagttt caggatcgaa aagcgggaca cggtgatttt ccagttgcat 481 ccctgggttt tctctttgtt tcagtcgctt tatcagcatt tcaaatgtgg gaaccataga 541 cggaccccgc cccctgcctt ccgccttcgc tgggcgtggc gacagtggga cgccaaaaca 601 aattctgggc caaaacaaat ttctcaaagc gcaacagttg acaacttagt tacacggaaa 661 aaatatatat ttaatgcgac ttaagaaaat gagatgtaaa atgtataaat gttaataaat 721 ccaata