Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_070218813             726 bp    mRNA    linear   INV 09-DEC-2024
            (LOC138913836), transcript variant X2, mRNA.
ACCESSION   XM_070218813
VERSION     XM_070218813.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..726
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..726
                     /gene="LOC138913836"
                     /note="uncharacterized LOC138913836; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:138913836"
     CDS             300..539
                     /gene="LOC138913836"
                     /codon_start=1
                     /product="uncharacterized protein isoform X2"
                     /protein_id="XP_070074914.1"
                     /db_xref="GeneID:138913836"
                     /translation="MMLWLMGLCLKFISSGIEKWDTTKDLYGKIMTKLGVAYGIVSEV
                     YQFQDRKAGHGDFPVASLGFLFVSVALSAFQMWEP"
ORIGIN      
        1 aggctcctct aaatatgcaa aagaagaaca aaaagctctc tataaaatta aatagccgta
       61 tgggttcgag gcgtcttttt acatgctgtg aaacatggga aaacaggtcg taaagtcggt
      121 ctaaaaactc taaaaactag aaacttcgaa ataaaagtgc cagtaaacga tatgtgcacg
      181 gtttctgtcg tcgtaaaaaa cagcgagtga cgtacagaat tttcacactc gcaaatcgtg
      241 cccttggccc tcgagtcgag ttaaagctaa atctaaaacc aaagctgaag cgaaagatta
      301 tgatgctatg gttaatggga ttgtgtctga agttcatcag ttccgggatc gaaaagtggg
      361 atacgactaa agatctatat ggcaagatta tgactaaact aggggtagct tatgggattg
      421 tttctgaagt ttatcagttt caggatcgaa aagcgggaca cggtgatttt ccagttgcat
      481 ccctgggttt tctctttgtt tcagtcgctt tatcagcatt tcaaatgtgg gaaccataga
      541 cggaccccgc cccctgcctt ccgccttcgc tgggcgtggc gacagtggga cgccaaaaca
      601 aattctgggc caaaacaaat ttctcaaagc gcaacagttg acaacttagt tacacggaaa
      661 aaatatatat ttaatgcgac ttaagaaaat gagatgtaaa atgtataaat gttaataaat
      721 ccaata