Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218811 814 bp mRNA linear INV 09-DEC-2024 (LOC138913835), mRNA. ACCESSION XM_070218811 VERSION XM_070218811.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..814 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..814 /gene="LOC138913835" /note="uncharacterized LOC138913835; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:138913835" CDS 116..712 /gene="LOC138913835" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_070074912.1" /db_xref="GeneID:138913835" /translation="MDSFREKLVFKKEWESMSLDEYYEKNVKKTNFKPPRSKPHSWRS ESDSHYRRTHYFASDYRQKPVNLLNLRLDILCSQIIDVKVVVASKGQVDFAQKRLVQI KKRLAQVPAKVSPPKVSPPKASLSKASPPKASLPEEEKKIESKEDSPVPIPNSPGTPE TQDIDDTLVLTIGDEVLYDEAYTMDTLWMPDGGNRNES" ORIGIN 1 ccttttcaac tgacaagcca aaggcctagg acgtacagaa aaaagaatct agacttgcaa 61 aagaaattaa aactgatagg aaaaactact tgaaaaaaaa aactgatagg aaaagatgga 121 cagcttccgt gaaaaattgg ttttcaagaa ggaatgggag tcgatgtcgt tggatgaata 181 ttacgagaag aacgtgaaga agacgaactt caagccgccc cgttctaagc cgcattcttg 241 gcggtcggag tcggattcac actaccggcg aacgcattac tttgcctccg actaccgcca 301 gaagccggtt aacctgctca acctgcggct ggatatcctg tgcagccaga tcatcgacgt 361 caaggtcgtg gtggcctcca agggccaggt ggacttcgcc cagaagcggc tggtgcagat 421 caagaagcgc ctggcccagg tgcctgcgaa ggtttctccg ccgaaggttt ctcctccgaa 481 ggcttctctt tcgaaggctt ctcctccgaa ggcttctctt ccggaagagg aaaagaagat 541 cgaatcgaag gaagattctc cggttccgat tccaaattcg ccaggtaccc cggaaaccca 601 ggacatcgat gataccctgg tcctcaccat cggcgacgag gtgctctacg atgaggccta 661 cacaatggac actctctgga tgcccgacgg tggcaatcgc aacgaatcct aatccaaaac 721 tctaaaactc cgaaactcca gcgactatga cacaagaagc cgtggaagtt gaaaaaccac 781 ctggccagca tttgacaaat aaataaatca tgtt