Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_070218811             814 bp    mRNA    linear   INV 09-DEC-2024
            (LOC138913835), mRNA.
ACCESSION   XM_070218811
VERSION     XM_070218811.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..814
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..814
                     /gene="LOC138913835"
                     /note="uncharacterized LOC138913835; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:138913835"
     CDS             116..712
                     /gene="LOC138913835"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_070074912.1"
                     /db_xref="GeneID:138913835"
                     /translation="MDSFREKLVFKKEWESMSLDEYYEKNVKKTNFKPPRSKPHSWRS
                     ESDSHYRRTHYFASDYRQKPVNLLNLRLDILCSQIIDVKVVVASKGQVDFAQKRLVQI
                     KKRLAQVPAKVSPPKVSPPKASLSKASPPKASLPEEEKKIESKEDSPVPIPNSPGTPE
                     TQDIDDTLVLTIGDEVLYDEAYTMDTLWMPDGGNRNES"
ORIGIN      
        1 ccttttcaac tgacaagcca aaggcctagg acgtacagaa aaaagaatct agacttgcaa
       61 aagaaattaa aactgatagg aaaaactact tgaaaaaaaa aactgatagg aaaagatgga
      121 cagcttccgt gaaaaattgg ttttcaagaa ggaatgggag tcgatgtcgt tggatgaata
      181 ttacgagaag aacgtgaaga agacgaactt caagccgccc cgttctaagc cgcattcttg
      241 gcggtcggag tcggattcac actaccggcg aacgcattac tttgcctccg actaccgcca
      301 gaagccggtt aacctgctca acctgcggct ggatatcctg tgcagccaga tcatcgacgt
      361 caaggtcgtg gtggcctcca agggccaggt ggacttcgcc cagaagcggc tggtgcagat
      421 caagaagcgc ctggcccagg tgcctgcgaa ggtttctccg ccgaaggttt ctcctccgaa
      481 ggcttctctt tcgaaggctt ctcctccgaa ggcttctctt ccggaagagg aaaagaagat
      541 cgaatcgaag gaagattctc cggttccgat tccaaattcg ccaggtaccc cggaaaccca
      601 ggacatcgat gataccctgg tcctcaccat cggcgacgag gtgctctacg atgaggccta
      661 cacaatggac actctctgga tgcccgacgg tggcaatcgc aacgaatcct aatccaaaac
      721 tctaaaactc cgaaactcca gcgactatga cacaagaagc cgtggaagtt gaaaaaccac
      781 ctggccagca tttgacaaat aaataaatca tgtt