Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218781 1005 bp mRNA linear INV 09-DEC-2024 (LOC138913830), mRNA. ACCESSION XM_070218781 VERSION XM_070218781.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1005 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1005 /gene="LOC138913830" /note="uncharacterized LOC138913830; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:138913830" CDS 86..937 /gene="LOC138913830" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_070074882.1" /db_xref="GeneID:138913830" /translation="MSSKAIEETIGQVPNFQNEELEVEVSVAETDNIGGHPEGNEVQA IENPNGDLELDNNQGANSSDDEPGETTPPRAPTPMPLEDQSVSTEPDGARDWRDIGSP EQPLGEFALSPESQPQTPQHEDEDAGDGNPFPVEEPPAKRENGEPGNPDQGSHPSCSE RKSPTELDLPGTSYEKVQTSVQTAVDSLAIQDALHNQVAATEPEPEQPGAPQPETIQP NDGDTPTPSFACPPTPEDSDKEEEDTKDTPSVAHPPTPEKSNDEEEEGGDSGPPTKKF KPKSSPS" misc_feature <284..>931 /gene="LOC138913830" /note="DNA translocase FtsK; Provisional; Region: PRK10263" /db_xref="CDD:236669" ORIGIN 1 gccttataca aatttagttc gtcgaatttc atcttgtcat tcagatcaga gtttgctgct 61 ttggaagcaa ctaacttttt tagctatgtc atccaaagct attgaggaaa ccattggaca 121 ggttcctaac ttccagaacg aagagctcga agtagaagtc tccgtggcag agactgataa 181 catcggagga cacccggagg gaaatgaagt ccaggccatc gaaaacccga atggagacct 241 agaactggac aacaaccaag gggcgaattc gagcgatgac gagccgggcg agacgactcc 301 accccgtgct ccgactccga tgccactcga ggaccagagc gtctcgacgg agccagatgg 361 ggcccgcgat tggcgcgata ttggcagtcc cgagcagccc ctgggtgagt tcgccctatc 421 gcccgagtcc cagccccaaa cgccacagca cgaggacgag gatgccggag acggaaaccc 481 ttttcctgta gaggagccac cagccaagag agagaatgga gagcccggca accctgacca 541 gggtagtcac ccatcttgtt ccgagaggaa gagcccaacc gagctggacc taccaggaac 601 ctcctacgaa aaggttcaga cctcggtgca gaccgccgtt gattcactgg ccattcagga 661 tgctttgcac aaccaagtcg ccgctactga gccggagcca gaacaaccag gggctcctca 721 acccgaaacc attcaaccca acgatggaga caccccaacc ccatcgttcg cttgtcctcc 781 aaccccggag gactccgaca aagaggaaga agacaccaag gacaccccat ctgttgccca 841 tcctccaact ccagagaagt ccaacgatga agaagaagaa ggaggagaca gcggtcctcc 901 tacaaagaaa tttaaaccta aatctagccc cagctagttc tatataatat catttatgtt 961 cctatgcacg cggttcaaaa taaaataatc tggttttgtt aatga