Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_070218778            1213 bp    mRNA    linear   INV 09-DEC-2024
            (LOC138913829), mRNA.
ACCESSION   XM_070218778
VERSION     XM_070218778.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1213
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1213
                     /gene="LOC138913829"
                     /note="uncharacterized LOC138913829; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:138913829"
     CDS             101..682
                     /gene="LOC138913829"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_070074879.1"
                     /db_xref="GeneID:138913829"
                     /translation="MKYEMDIDDVAGGVGAESAPQLVNPSSGVARVQVPNSAGHSQPE
                     METDGAGAPIGNDEGDVVVKCIKFHYETCRNTACIICYPLQGIIFGSQTNGSNGSQNA
                     SVQTDETSSRNPELDSEVLHANQCSTSNCRVSNCTVLKGVLVHLNNCRRPVDCPMEHC
                     YMSRKALLHYSACTSSGCLCSYFRRAAAWLQQQ"
     misc_feature    461..634
                     /gene="LOC138913829"
                     /note="TAZ zinc finger; Region: zf-TAZ; pfam02135"
                     /db_xref="CDD:460457"
ORIGIN      
        1 gaggcgccac aaatatcgat ttaaatcctt ctctttttaa cgcagccggt gttgaagtgt
       61 caggaattat tggagccgca attaagttcc caatttcact atgaaatacg agatggacat
      121 cgacgacgtg gctggtggag taggagcaga gagcgcacca caattggtca atccgtcttc
      181 cggagttgcc cgagttcagg ttccgaatag tgccggtcat tcccagccag aaatggaaac
      241 cgatggagca ggtgctccaa ttggtaatga tgaaggcgat gtcgtcgtca agtgcatcaa
      301 gtttcattac gagacttgcc gcaacaccgc ctgcattatt tgttatcctc ttcaggggat
      361 tattttcggt tctcaaacga atggatcgaa tggatcccag aatgccagcg tgcaaactga
      421 tgaaactagt tccaggaatc ccgaactgga ttccgaggtg ctgcatgcca accagtgcag
      481 cacatcgaac tgccgggtct ccaactgcac ggtgttgaaa ggtgtgctgg tccatctcaa
      541 caactgccgt cgtccggtcg actgtcccat ggagcactgc tacatgtcgc gcaaggccct
      601 tttgcactac tcggcctgca cgagcagtgg ctgcctttgc tcctactttc gccgcgcagc
      661 agcctggctc cagcagcagt aggatcatca gacctaaccc caaatgtggg taacataagt
      721 aggaaattat attcctaaaa ttaccaaaga agaaaacaaa aaatagatat tattacaaac
      781 gaatatttgt aaaatatcga tatggaatgc taccgatatg tgatattatg tggtgatatt
      841 ccagtaccta cacgatttac aaaacttgga aaatatttcc ctaacatcac cacacaaaaa
      901 ttctgttaaa atatggatat agaatgcaaa tatttctagc agtgatattc cagtacctac
      961 aaaccgattt acaaaacttg gaaaatattt ccttaaaatt accaaaaaca aataccgtta
     1021 aaaacatgga tctggaatgc aaccgaccac ccgaatattt gcatatttcc agcagtgata
     1081 ttccagtacc tctaaaacga tttacaagac tgggaaaata tttccttaaa actgccaaat
     1141 aaaaacttat tataaacaaa ttttgttaaa aaacataaat atttgaatat accaccactg
     1201 tgcctagaac gtg