Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218777 788 bp mRNA linear INV 09-DEC-2024 (LOC108059386), transcript variant X2, mRNA. ACCESSION XM_070218777 VERSION XM_070218777.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..788 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..788 /gene="LOC108059386" /note="uncharacterized LOC108059386; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108059386" CDS 92..700 /gene="LOC108059386" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_070074878.1" /db_xref="GeneID:108059386" /translation="MQNSAQGKKASGEDACSSAACKVAAVVSKTKRKSHQFVTAPCVM PKPLVVDGNTAIFQVGGEQAKMGDIPALSQLSGGSGGQPIYRIKPGTHAHVVNYIVVD EGCDSNLMKKANSGDPEAMRQLLGLQRGTAVSKLQKLIAARRGNPPSNLVIRPSVPTP GGPGGPGGASVGSGHVSTPQMHPDLSIASVKGGVPFVRQSPR" ORIGIN 1 cgcatgccca cgtgacttac tctaacaatt tcgtagaaaa agccagaaga agacgacgct 61 gattttgcca aagaacccgt tggcccacga aatgcagaac tccgcccaag ggaaaaaagc 121 ttctggcgag gatgcctgca gctcagccgc atgcaaagtg gctgctgtgg tgagcaagac 181 caagcggaag agccaccagt tcgtcacggc gccgtgcgta atgcccaagc cactggtcgt 241 ggatgggaac accgcaatct tccaggtggg cggcgagcag gcgaagatgg gcgacattcc 301 ggccctttcg cagctcagcg gaggctctgg cggccagccc atctaccgga tcaagccggg 361 aacgcatgcg catgtcgtca actacatagt cgtcgacgag ggatgcgact ccaatctgat 421 gaagaaggcc aactccggtg acccggaagc catgcgtcaa ctgttggggc ttcagcgcgg 481 gactgccgtg agcaagctgc agaagctcat cgccgctcgc cggggcaatc cacccagtaa 541 cctcgtgatc cgtccctcgg tcccaactcc tggaggccca ggaggccctg gaggcgcttc 601 cgtgggcagt ggacatgtat ccacgcccca gatgcatccg gacctctcca ttgccagcgt 661 gaagggaggc gttccattcg tccgccagtc tccgaggtga atccttctgc gaggcacgga 721 acccataact gagtttgaaa actagtgaag aacactcgtt tttaataaaa tattgattgg 781 tgaacatt