Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218767 837 bp mRNA linear INV 09-DEC-2024 protein F (LOC108057299), mRNA. ACCESSION XM_070218767 VERSION XM_070218767.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..837 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..837 /gene="LOC108057299" /note="serine-aspartate repeat-containing protein F; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108057299" CDS 133..729 /gene="LOC108057299" /codon_start=1 /product="serine-aspartate repeat-containing protein F" /protein_id="XP_070074868.1" /db_xref="GeneID:108057299" /translation="MMAGEAAKLKRDCSSATQKEKKTECPTLGAIFLNEEAELSSSSV SSEPTSSGETDSEANSTSDPDANAKVDDDPQVSLYSPLAGDSDNELDEVEVFCEETIS LLAHEILCCEGDSDSEAETETETDGEDTDEAKDNDKLEEILEYGLHNPYQLMFSEEDD EEETPDESPKTEDSLPILLDEDQPSEEKPEVNQAGAFY" ORIGIN 1 caaagccatt ccagcacgca tagaaacaag ttcggaatct ctacgggagg cagtcagaca 61 gccggaggca catagcatat agaatatata gagagagggt cgggatcgga atcggaaccc 121 aaatcgggat caatgatggc tggcgaagcg gccaagttaa agcgggactg ctcctcggcg 181 acccagaagg aaaagaaaac ggaatgcccc acgttgggcg ccattttcct gaacgaggag 241 gcagagctgt ccagtagctc ggttagcagt gagccaacca gctctggaga aacagatagc 301 gaagccaaca gcacatccga tccagatgcg aacgccaaag tggacgatga tcctcaggtg 361 agcctgtaca gtccgctggc tggggattcg gacaacgaac tggacgaggt ggaggtcttc 421 tgcgaagaga ccatctccct gctggcccac gagatcctct gctgcgaggg tgacagcgat 481 tcggaggcgg agacggagac agagaccgat ggcgaggaca ccgacgaggc caaggacaat 541 gacaagctgg aggagatcct ggagtacggc ctgcacaatc cctaccagct catgttcagc 601 gaggaggacg acgaggagga gaccccagat gaaagtccca agacggagga cagcttgccg 661 atcctgctgg acgaggatca acccagcgag gagaagcccg aggtgaacca ggcaggtgct 721 ttctactaaa gaaaatctgg gttactgcag gtggttttca catttctacc attcacaagc 781 ttcgaataaa attcagtggg gtattttgtg gccttccaaa ttatagctaa accatta