Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii serine-aspartate repeat-containing


LOCUS       XM_070218767             837 bp    mRNA    linear   INV 09-DEC-2024
            protein F (LOC108057299), mRNA.
ACCESSION   XM_070218767
VERSION     XM_070218767.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..837
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..837
                     /gene="LOC108057299"
                     /note="serine-aspartate repeat-containing protein F;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 1 Protein"
                     /db_xref="GeneID:108057299"
     CDS             133..729
                     /gene="LOC108057299"
                     /codon_start=1
                     /product="serine-aspartate repeat-containing protein F"
                     /protein_id="XP_070074868.1"
                     /db_xref="GeneID:108057299"
                     /translation="MMAGEAAKLKRDCSSATQKEKKTECPTLGAIFLNEEAELSSSSV
                     SSEPTSSGETDSEANSTSDPDANAKVDDDPQVSLYSPLAGDSDNELDEVEVFCEETIS
                     LLAHEILCCEGDSDSEAETETETDGEDTDEAKDNDKLEEILEYGLHNPYQLMFSEEDD
                     EEETPDESPKTEDSLPILLDEDQPSEEKPEVNQAGAFY"
ORIGIN      
        1 caaagccatt ccagcacgca tagaaacaag ttcggaatct ctacgggagg cagtcagaca
       61 gccggaggca catagcatat agaatatata gagagagggt cgggatcgga atcggaaccc
      121 aaatcgggat caatgatggc tggcgaagcg gccaagttaa agcgggactg ctcctcggcg
      181 acccagaagg aaaagaaaac ggaatgcccc acgttgggcg ccattttcct gaacgaggag
      241 gcagagctgt ccagtagctc ggttagcagt gagccaacca gctctggaga aacagatagc
      301 gaagccaaca gcacatccga tccagatgcg aacgccaaag tggacgatga tcctcaggtg
      361 agcctgtaca gtccgctggc tggggattcg gacaacgaac tggacgaggt ggaggtcttc
      421 tgcgaagaga ccatctccct gctggcccac gagatcctct gctgcgaggg tgacagcgat
      481 tcggaggcgg agacggagac agagaccgat ggcgaggaca ccgacgaggc caaggacaat
      541 gacaagctgg aggagatcct ggagtacggc ctgcacaatc cctaccagct catgttcagc
      601 gaggaggacg acgaggagga gaccccagat gaaagtccca agacggagga cagcttgccg
      661 atcctgctgg acgaggatca acccagcgag gagaagcccg aggtgaacca ggcaggtgct
      721 ttctactaaa gaaaatctgg gttactgcag gtggttttca catttctacc attcacaagc
      781 ttcgaataaa attcagtggg gtattttgtg gccttccaaa ttatagctaa accatta