Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218749 1430 bp mRNA linear INV 09-DEC-2024 12 homolog (LOC138911820), mRNA. ACCESSION XM_070218749 VERSION XM_070218749.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1430 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1430 /gene="LOC138911820" /note="DDB1- and CUL4-associated factor 12 homolog; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:138911820" CDS 21..1358 /gene="LOC138911820" /codon_start=1 /product="DDB1- and CUL4-associated factor 12 homolog" /protein_id="XP_070074850.1" /db_xref="GeneID:138911820" /translation="MFHWLVKTVRTYPSSRVSSAELEERRAKKLEQSASESGSGTVAT PKQEKEQVSYNILDYLQSRENGLSDRHIVNVESTSRCVLTHNILRENRIELGDIGTVI CSKWLSHQQLIIGTRSNKLLVYDLNTRRVDNIPTVIGHAHTEGHWGDQRAIELSPSRS FLATTVGTYSTEMAVYRLPTLEPVYVAEYGHTTKISGMTWLDDHYLVSGSSDSGIVLW GMIDNHHTEPPDIDEEAAAYPDFATIYLINLMKPPLQEISSLCFKKEFKEIAAVSTSG SMHIVNSDTFQLKLSREVPHSQYNTGIVFHSDGLYAVRSEDFTILLDARTLETVKEIT LSRREGLFLTTSIEGNILTTGTSEGMVMFYDIRAAKFLESTVDASRPTALMCSPTIAK NRHQDADLRSGRTTLHLAEQLCGRLEINQQRMRLAHFDSNRSPAYVFRQVHRQ" misc_feature <348..1136 /gene="LOC138911820" /note="WD40 repeat [General function prediction only]; Region: WD40; COG2319" /db_xref="CDD:441893" misc_feature 474..590 /gene="LOC138911820" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 792..899 /gene="LOC138911820" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 918..1028 /gene="LOC138911820" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 1038..1151 /gene="LOC138911820" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" ORIGIN 1 cctaagtaga acaaagtaac atgtttcatt ggttagttaa aacagttcgc acctacccgt 61 ccagccgcgt gtcctcggcg gagctggagg agcggcgggc caagaagttg gagcaatcgg 121 ccagcgagag cggaagcggt accgtggcga cgccaaagca ggagaaggag caagtatctt 181 acaatatcct tgactatctc caaagccggg aaaacggact aagcgatcgg cacatcgtaa 241 atgtagaaag caccagccgc tgcgtgctaa cccacaatat actccgcgag aaccgcatcg 301 agctgggcga cataggcacg gtgatttgct ccaaatggct tagccatcag caactgatca 361 tcgggaccag gtccaacaag ctgctcgtct acgatctgaa cacgcggcgg gtggacaaca 421 tccccacggt aatcggccat gcccataccg aggggcactg gggtgatcag cgggccatcg 481 agctgtcgcc cagccgctcc tttttggcca ctacagtagg cacatactcg accgaaatgg 541 cagtataccg gctgccaacg ctggaacccg tctacgtggc cgagtatggg cacaccacca 601 aaatatcggg catgacctgg ctggatgatc attatctggt ctccggctcc agcgattccg 661 gcatcgtttt gtggggaatg atcgataacc atcacacgga gcccccggat attgacgagg 721 aggcggcggc gtacccggac tttgccacaa tttatcttat caatctcatg aaacctcccc 781 tccaggagat cagttctctt tgcttcaaga aggagttcaa ggagatcgcc gccgtctcca 841 caagcggatc catgcacatc gtaaactcgg ataccttcca gctgaagctc tcccgcgaag 901 tgccacacag tcagtacaat acaggcattg tctttcacag cgacggtctg tatgccgtac 961 gttctgagga ctttactatc ctgctggacg cgcggacgct tgagacagtc aaggagatca 1021 ccctctcccg ccgggagggc ctatttctga ccacatcaat agaagggaat attctgacca 1081 ctggaacgag tgagggcatg gtaatgttct acgacatccg tgccgcgaag tttttggaga 1141 gcactgtgga tgcttcgcgc cccactgcac tgatgtgcag ccctacaatt gcgaaaaaca 1201 ggcaccagga tgcggatctt cgcagcgggc ggaccacact ccatcttgca gagcaattat 1261 gcggccgttt ggaaataaat caacagagga tgcgattggc gcattttgat tccaatcgtt 1321 cacctgcata cgtattccgc caagtccacc gccaataaac ataatacaca attaccgatc 1381 cttgttatgt ataatacaca caatacaaat aatggaatgc aaatttatag