Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218744 1088 bp mRNA linear INV 09-DEC-2024 protein 3 homolog (LOC108056135), transcript variant X2, mRNA. ACCESSION XM_070218744 VERSION XM_070218744.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1088 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1088 /gene="LOC108056135" /note="thioredoxin domain-containing protein 3 homolog; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:108056135" CDS 166..1056 /gene="LOC108056135" /codon_start=1 /product="thioredoxin domain-containing protein 3 homolog isoform X2" /protein_id="XP_070074845.1" /db_xref="GeneID:108056135" /translation="MAKKGGVQQLQADLASDEEFEKFLQRSGLLVLDIYSEWCGPCLG MVGSLRKIKLELGGDNLQLAICKAGSISSLKRFNKKSEPTWMFVTNGKAINIMFGTDV PKLVAMITRMLQSTMAKESHVSYEITELQPMELEQLEVRNKALRLAEEIELAESRRKR LEYLHSVTDCIMANLPDIGITVFGPQVNRDMFKKLSEPADPLKIQCKDRKVFAILPSD MATVNFAAENPLAPEVIQLLYDKELLMCFWKVEEVLGTPPTVLRQYAHELTKETIKPP DEFNEEEITVPPMIVPLEDH" misc_feature 196..498 /gene="LOC108056135" /note="The thioredoxin (TRX)-like superfamily is a large, diverse group of proteins containing a TRX fold. Many members contain a classic TRX domain with a redox active CXXC motif. They function as protein disulfide oxidoreductases (PDOs), altering the redox...; Region: Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold; cl00388" /db_xref="CDD:469754" misc_feature 862..>1047 /gene="LOC108056135" /note="Domain of unknown function (DUF4746); Region: DUF4746; pfam15928" /db_xref="CDD:435025" ORIGIN 1 ttataaggat ttctcataaa tacatatata tacagcgaga tgttggcaaa tcctgcgtgc 61 cttttctcgc ttgacaaccg gcgttttatc aatacctggt gttcagttcg gaaactgaaa 121 ctgattaatg gctgaagtga agtgaagtga gtcagtgaac gaaaaatggc gaagaaggga 181 ggagtccagc agctccaggc ggacctcgcc tctgacgagg agttcgagaa gttcctgcag 241 cgatccggac tgctggtact cgacatatac tccgaatggt gcggaccgtg cctgggaatg 301 gtgggcagcc tgcggaagat caagctcgaa ttgggaggcg ataacctgca gttggccatc 361 tgcaaggcgg gttccatatc ctccctgaag cgattcaaca agaagagcga accgacctgg 421 atgttcgtta cgaatggcaa ggcaatcaac atcatgttcg gcacggacgt gcccaagctg 481 gtggccatga tcacccggat gctgcagtcg acgatggcca aggagtcgca cgtgagctac 541 gagatcaccg agctgcagcc gatggagctg gagcagctgg aggtgcgcaa caaggcgctg 601 cgcctggccg aggagatcga gctggcggag agcaggcgca agaggctgga gtatctgcac 661 agcgtcaccg actgcatcat ggccaacctg ccggatatcg ggatcacggt gttcggaccg 721 caggttaatc gcgacatgtt caagaagctc tcggagcccg ccgatcccct gaagatccag 781 tgcaaggacc gcaaggtctt cgccattctg cccagcgaca tggcgacggt gaactttgcg 841 gccgagaatc ccttggcgcc ggaggtcatc caactgctct acgacaagga gctgctcatg 901 tgcttctgga aggtcgagga ggtgctcggc acaccgccca ccgtgctccg ccagtacgcc 961 cacgagctga ccaaggagac catcaagccg cccgatgagt tcaacgagga ggagatcacc 1021 gtgccgccca tgatagtgcc gctggaggat cactagccgg gtcgatttag ccatgtccgt 1081 atgtccgt