Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_070218740             743 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108056407), transcript variant X2, mRNA.
ACCESSION   XM_070218740
VERSION     XM_070218740.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..743
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..743
                     /gene="LOC108056407"
                     /note="uncharacterized LOC108056407; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108056407"
     CDS             146..670
                     /gene="LOC108056407"
                     /codon_start=1
                     /product="uncharacterized protein isoform X2"
                     /protein_id="XP_070074841.1"
                     /db_xref="GeneID:108056407"
                     /translation="MVAFSWEESLGSSVELLHQTTGATRLSQSLAAAQERTQVLEERN
                     RRLKDLAMDKSDLFESRGLMLCSRVFDLSQELIVTRMRINDFENACTQLRRRILELKL
                     RRVQRRRLLCHEMQQLRLAQELQVPPVLRRLWHGLRFLWNCVECLAQVSHVARPPGKA
                     ESTMDALNLFVAGF"
ORIGIN      
        1 cccaactgat ttacccgcgt ttgcagtcga aattccaaat taagcaccga gatggcctct
       61 ccaggtggga atccccagcg atcctggcaa tcgtggcgcc tgctcaacga gggcttcaag
      121 tttttcgcca ccaggctggg caggaatggt ggctttcagc tgggaggagt ccctgggcag
      181 cagcgtcgag ctcctccatc agacgaccgg cgcgaccaga ttgtcccaga gcctggccgc
      241 cgcccaggag cgcacccagg tgctggagga gcggaaccgc aggctgaagg atctggcgat
      301 ggacaagtcg gatctcttcg agtcgcgggg cctgatgctg tgctcccggg tcttcgacct
      361 cagccaggag ctgatcgtga ccaggatgcg gatcaacgac ttcgagaacg cctgcacgca
      421 gctgcgaagg cgcatcttgg agctgaagct gcgacgcgtc cagcgccgac ggctcctctg
      481 ccacgagatg cagcagctgc gcctggcgca ggagctccag gtgccccccg tcctgaggcg
      541 cctgtggcac ggcctccgct tcctgtggaa ctgcgtggag tgcctggcgc aggtgagcca
      601 cgtggcgcgt cctcctggga aggcggagag cacgatggac gccctcaatt tgttcgtggc
      661 gggcttttga catgtcctgt cttgtccgcc cagcggctaa gtgttttaca acactatcga
      721 ataatttgtt atattttaaa tat