Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218740 743 bp mRNA linear INV 09-DEC-2024 (LOC108056407), transcript variant X2, mRNA. ACCESSION XM_070218740 VERSION XM_070218740.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..743 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..743 /gene="LOC108056407" /note="uncharacterized LOC108056407; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108056407" CDS 146..670 /gene="LOC108056407" /codon_start=1 /product="uncharacterized protein isoform X2" /protein_id="XP_070074841.1" /db_xref="GeneID:108056407" /translation="MVAFSWEESLGSSVELLHQTTGATRLSQSLAAAQERTQVLEERN RRLKDLAMDKSDLFESRGLMLCSRVFDLSQELIVTRMRINDFENACTQLRRRILELKL RRVQRRRLLCHEMQQLRLAQELQVPPVLRRLWHGLRFLWNCVECLAQVSHVARPPGKA ESTMDALNLFVAGF" ORIGIN 1 cccaactgat ttacccgcgt ttgcagtcga aattccaaat taagcaccga gatggcctct 61 ccaggtggga atccccagcg atcctggcaa tcgtggcgcc tgctcaacga gggcttcaag 121 tttttcgcca ccaggctggg caggaatggt ggctttcagc tgggaggagt ccctgggcag 181 cagcgtcgag ctcctccatc agacgaccgg cgcgaccaga ttgtcccaga gcctggccgc 241 cgcccaggag cgcacccagg tgctggagga gcggaaccgc aggctgaagg atctggcgat 301 ggacaagtcg gatctcttcg agtcgcgggg cctgatgctg tgctcccggg tcttcgacct 361 cagccaggag ctgatcgtga ccaggatgcg gatcaacgac ttcgagaacg cctgcacgca 421 gctgcgaagg cgcatcttgg agctgaagct gcgacgcgtc cagcgccgac ggctcctctg 481 ccacgagatg cagcagctgc gcctggcgca ggagctccag gtgccccccg tcctgaggcg 541 cctgtggcac ggcctccgct tcctgtggaa ctgcgtggag tgcctggcgc aggtgagcca 601 cgtggcgcgt cctcctggga aggcggagag cacgatggac gccctcaatt tgttcgtggc 661 gggcttttga catgtcctgt cttgtccgcc cagcggctaa gtgttttaca acactatcga 721 ataatttgtt atattttaaa tat