Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Odorant-binding protein 8a


LOCUS       XM_070218715            1076 bp    mRNA    linear   INV 09-DEC-2024
            (Obp8a), mRNA.
ACCESSION   XM_070218715
VERSION     XM_070218715.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1076
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1076
                     /gene="Obp8a"
                     /note="Odorant-binding protein 8a; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 10
                     Proteins"
                     /db_xref="GeneID:108063498"
     CDS             105..629
                     /gene="Obp8a"
                     /codon_start=1
                     /product="uncharacterized protein Obp8a"
                     /protein_id="XP_070074816.1"
                     /db_xref="GeneID:108063498"
                     /translation="MARRSHIWLLRLYLLLLSLTLDPSAVLAIRSPQSLALLRARDQC
                     GRQLTLAQRLHLDRMQFEDAPHVRHYLHCFWSRLRLWQDASGFQALRIVQSFGGERRL
                     NVEQALPAINGCNARTRFRSGSRSVSRSGSGSQSRSQVPVVDWCFRAFVCVLATPVGD
                     WYRRHMSDVINGNA"
     misc_feature    222..569
                     /gene="Obp8a"
                     /note="Insect pheromone/odorant binding protein domains;
                     Region: PhBP; smart00708"
                     /db_xref="CDD:214783"
ORIGIN      
        1 caacccattt ccacttacca ggttagtcgg gttggataag tcccaccgat ctttgtagaa
       61 cttagtccag ctttgcgact gcagcggagg agatctccaa cggaatggca cggcgatcgc
      121 atatctggtt gctcaggctg tatttactgc tcctttcgtt gacattggat ccttcagcgg
      181 tcctggccat ccgctcgccc cagtcgctgg cactcctgcg ggctcgagat cagtgcggca
      241 ggcagctgac cctcgcccag cgcctccacc tggacaggat gcagttcgag gacgctccgc
      301 acgtgcgcca ctacctccat tgcttctggt cgcgcctgcg gctctggcag gatgcctccg
      361 gcttccaggc gctgcgcatc gtccagagtt tcggtggcga gagacgcctc aatgtggagc
      421 aggcgctgcc ggccatcaat gggtgcaatg cgaggacgcg gtttcgatcg ggatcgagat
      481 cggtttcgag atcaggatca ggatcccaat caagatccca ggtcccagtg gtcgactggt
      541 gtttccgggc ctttgtctgc gtgctggcca cgccagtggg cgattggtac aggcgccaca
      601 tgtccgatgt catcaatgga aatgcctaaa aatcgaattt tatagtttaa gaataaaata
      661 taaaaaactc ataaaaaaaa atataagtgt caaagaaatt tgtctaaagc tacaaagaat
      721 taggattgcc aacagtaagg taaacaaaaa ttatacataa atatataaat atttgtaatt
      781 attcagtaag ttataaaaac aagaatactt ccatacaaag aatgtgaatt catgaaaatt
      841 ctacattata aatcaataaa aaataaataa gcaaagtaat ttttccatac aaagaattag
      901 gattgtcacc aacttttcta tagctataaa gaattgggat tgccaacaat aaggtaaaca
      961 aaaattatac ataaatattt gtaactaatt agtaagatat aaaaacaaaa ttttagtata
     1021 taaaagggat tttccatata aagaattagg attaccaaca aataataata accgta