Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218715 1076 bp mRNA linear INV 09-DEC-2024 (Obp8a), mRNA. ACCESSION XM_070218715 VERSION XM_070218715.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1076 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1076 /gene="Obp8a" /note="Odorant-binding protein 8a; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins" /db_xref="GeneID:108063498" CDS 105..629 /gene="Obp8a" /codon_start=1 /product="uncharacterized protein Obp8a" /protein_id="XP_070074816.1" /db_xref="GeneID:108063498" /translation="MARRSHIWLLRLYLLLLSLTLDPSAVLAIRSPQSLALLRARDQC GRQLTLAQRLHLDRMQFEDAPHVRHYLHCFWSRLRLWQDASGFQALRIVQSFGGERRL NVEQALPAINGCNARTRFRSGSRSVSRSGSGSQSRSQVPVVDWCFRAFVCVLATPVGD WYRRHMSDVINGNA" misc_feature 222..569 /gene="Obp8a" /note="Insect pheromone/odorant binding protein domains; Region: PhBP; smart00708" /db_xref="CDD:214783" ORIGIN 1 caacccattt ccacttacca ggttagtcgg gttggataag tcccaccgat ctttgtagaa 61 cttagtccag ctttgcgact gcagcggagg agatctccaa cggaatggca cggcgatcgc 121 atatctggtt gctcaggctg tatttactgc tcctttcgtt gacattggat ccttcagcgg 181 tcctggccat ccgctcgccc cagtcgctgg cactcctgcg ggctcgagat cagtgcggca 241 ggcagctgac cctcgcccag cgcctccacc tggacaggat gcagttcgag gacgctccgc 301 acgtgcgcca ctacctccat tgcttctggt cgcgcctgcg gctctggcag gatgcctccg 361 gcttccaggc gctgcgcatc gtccagagtt tcggtggcga gagacgcctc aatgtggagc 421 aggcgctgcc ggccatcaat gggtgcaatg cgaggacgcg gtttcgatcg ggatcgagat 481 cggtttcgag atcaggatca ggatcccaat caagatccca ggtcccagtg gtcgactggt 541 gtttccgggc ctttgtctgc gtgctggcca cgccagtggg cgattggtac aggcgccaca 601 tgtccgatgt catcaatgga aatgcctaaa aatcgaattt tatagtttaa gaataaaata 661 taaaaaactc ataaaaaaaa atataagtgt caaagaaatt tgtctaaagc tacaaagaat 721 taggattgcc aacagtaagg taaacaaaaa ttatacataa atatataaat atttgtaatt 781 attcagtaag ttataaaaac aagaatactt ccatacaaag aatgtgaatt catgaaaatt 841 ctacattata aatcaataaa aaataaataa gcaaagtaat ttttccatac aaagaattag 901 gattgtcacc aacttttcta tagctataaa gaattgggat tgccaacaat aaggtaaaca 961 aaaattatac ataaatattt gtaactaatt agtaagatat aaaaacaaaa ttttagtata 1021 taaaagggat tttccatata aagaattagg attaccaaca aataataata accgta