Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Yippee-like (Ypel), transcript


LOCUS       XM_070218697             839 bp    mRNA    linear   INV 09-DEC-2024
            variant X3, mRNA.
ACCESSION   XM_070218697
VERSION     XM_070218697.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..839
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..839
                     /gene="Ypel"
                     /note="Yippee-like; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 5 Proteins"
                     /db_xref="GeneID:108068081"
     CDS             247..591
                     /gene="Ypel"
                     /codon_start=1
                     /product="protein yippee-like"
                     /protein_id="XP_070074798.1"
                     /db_xref="GeneID:108068081"
                     /translation="MVKTFQAYLPSTNRTYSCVHCRAHLASHDELISKSFQGSQGPAY
                     LFNSVVNVACGQTEERVLLTGLHAVADIYCECCKTPLGWKYEHAYESSQKYKEGKFII
                     ELAHMIKENGWD"
     misc_feature    289..561
                     /gene="Ypel"
                     /note="C-terminal domain of Retinoic acid-inducible gene
                     (RIG)-I-like Receptors, Cereblon (CRBN), and similar
                     protein domains; Region: RLR_C_like; cl13152"
                     /db_xref="CDD:472430"
     polyA_site      839
                     /gene="Ypel"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 catataataa tataatatca taccattctg gctataagaa ttattatttt atttattttt
       61 tgttcttaaa aagcagctca tgattttata atcatttcct tttttaaaat tgtgatacaa
      121 aaattgagtt ctattcaagt caaaaaagag gaccacttga aggacagaca accgcaggac
      181 ccaaaggacc tagtctataa ctttcgtaga aatatataga ggcccggaac tcaataacgt
      241 gtcacgatgg tgaagacgtt tcaggcctac ctaccgtcca cgaatcggac ctactcatgt
      301 gttcactgcc gcgcccacct cgcctcccac gacgagctca tctcgaagtc gttccagggc
      361 agccaggggc cggcctatct gttcaactcg gtggtgaacg tggcctgcgg ccagacggag
      421 gagcgggtgc tcctcaccgg cctccatgcg gtggcggaca tctactgcga gtgctgcaag
      481 acgccgctgg gctggaagta cgagcacgcc tacgagtcca gccagaagta caaggagggc
      541 aagttcatca tcgagctggc ccacatgatc aaggagaacg gctgggactg aagggctgtg
      601 tgggcgaata gaatccggag cacagccgtt acgggatcag gaaaaacagg aacagcagca
      661 tcagcagcag cagcgacgat gatgatggca gcgggaaaag cagcgagttc tctcaccaca
      721 caaatcaaaa tacacacgcg gcaaatggca gacatagagt gtttacaaaa tggctaaagt
      781 ctggagaatg gaaacaaaat gtgaagcaaa aacatagagg agcggaatcg agttttagg