Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218679 592 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_070218679 VERSION XM_070218679.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..592 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..592 /gene="LOC108056132" /note="acylphosphatase-1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108056132" CDS 102..416 /gene="LOC108056132" /codon_start=1 /product="acylphosphatase-1" /protein_id="XP_070074780.1" /db_xref="GeneID:108056132" /translation="MANEKKDDIMGCDFEIRGKVPKEAFQLFALAQAKTLGLRGFITQ VSEEKFKGRLEGEGKVIDAFKKLILAAAEYVQAIKEFIIRNLKVIQEYTYKTFEIKVE QK" misc_feature 135..398 /gene="LOC108056132" /note="Region: Acylphosphatase; cl00551" /db_xref="CDD:444972" ORIGIN 1 agtcagggtc atgaggtgct gagatcttgc cttcaagttc aacgagcttt gtcagtaaca 61 aaaatatata tacttttttt ggcaaccaaa atttactcga aatggccaac gaaaaaaaag 121 acgatatcat gggctgtgac tttgagatcc gcggcaaagt tcccaaagag gccttccaac 181 tgttcgccct cgcccaggct aaaactctgg gtctccgggg attcatcacc caggtgtcgg 241 aggagaagtt caagggtcgt ctggagggcg agggcaaggt gatcgatgcc ttcaagaagc 301 taatcctggc cgccgccgaa tatgtgcagg ccatcaagga attcatcatc cgaaatctga 361 aggtcatcca ggagtacacc tacaagacct ttgaaattaa agtggagcaa aagtgaaaag 421 ctgaaattaa ttaatttcag ttctatttaa attataacaa tttatttcac ccgaaaattt 481 aaatattaat ttttttggaa aacatttgtt aaatccgaac ccctggcacc ttgaaacttt 541 ttatttgaaa attcctagat attgtgaatg gccaaaaacc gaaataaatt gc