Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218638 568 bp mRNA linear INV 09-DEC-2024 (LOC108070098), transcript variant X2, mRNA. ACCESSION XM_070218638 VERSION XM_070218638.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..568 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..568 /gene="LOC108070098" /note="uncharacterized LOC108070098; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:108070098" CDS 60..530 /gene="LOC108070098" /codon_start=1 /product="uncharacterized protein isoform X2" /protein_id="XP_070074739.1" /db_xref="GeneID:108070098" /translation="MDIFAEQHINQFQDQDFPNKVQDPFLRFSSEEQKLPFSQLPSEI QDHKISSDIQNVDKFSIEIENQKQEFKDPEELPTEIVGPEKKELSNETQDISASEPLV NPRSRVIPPMPSEDTMRHSIADSLMEILVSDALQARSRILGILQRIDEKRRMST" ORIGIN 1 actcattcat tttcgtaaca gatcttaatt attataaatt tataatttgt aaggatataa 61 tggacatttt tgctgaacaa catattaatc aatttcaaga tcaagacttt ccaaataaag 121 tgcaggatcc gtttctgcgg ttttcaagtg aagagcaaaa acttcctttt agccagttgc 181 caagtgaaat tcaggatcat aagatctcca gtgatataca aaatgtggat aaattctcta 241 ttgaaattga aaatcaaaag caagaattta aggatccaga agaactgccc actgaaattg 301 ttggtccaga gaaaaaggag cttagcaatg aaacgcagga tatttccgcc tctgaaccac 361 tggttaatcc tcgtagtcgc gtgattccac ccatgccctc ggaggacacc atgcgccact 421 ccatagccga cagcctcatg gagatcctgg tgagcgatgc tctgcaggcg cgcagtcgaa 481 tcctgggcat cctgcagcga atcgacgaga agcgtaggat gtctacttag gtcaaattta 541 tcattatatc attttacaaa gatttttc