PREDICTED: Drosophila takahashii uncharacterized protein

LOCUS       XM_070218590             474 bp    mRNA    linear   INV 09-DEC-2024
            (LOC138913800), mRNA.
ACCESSION   XM_070218590
VERSION     XM_070218590.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 12% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..474
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..474
                     /gene="LOC138913800"
                     /note="uncharacterized LOC138913800; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:138913800"
     CDS             1..474
                     /gene="LOC138913800"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_070074691.1"
                     /db_xref="GeneID:138913800"
                     /translation="MHQMVRHNYFRTEQATKVQATLAAVAGPNGTKSEQSCKAVSSQK
                     APETLKNLLLRSSVPIVSANPNQNQNPNPQRDHPSAGTMAPLKGQEVLKFHKHSYLEN
                     RLFDHRLVKDNLLDKWPTADMNEYNERKDHRNLMESYVPATVHFITPITSCLTIL"
ORIGIN      
        1 atgcatcaaa tggtcaggca taattatttc cgcactgagc aagcgacaaa ggttcaggcc
       61 actctagctg cagtcgcagg accgaacgga accaaaagtg aacaaagttg caaggcagtc
      121 agttcgcaaa aggcgcccga aacgctgaag aaccttctgt tgcgatccag tgtaccgata
      181 gtgagtgcga atccgaatca gaatcagaat ccgaatcccc agagggacca cccatccgcc
      241 ggcaccatgg caccgctcaa agggcaggag gtgctcaagt tccacaagca ctcatatctc
      301 gagaaccgcc tcttcgatca ccgcctggtc aaggacaacc tgttggacaa gtggcccacc
      361 gccgatatga acgagtacaa cgagcgcaag gaccaccgca acctcatgga atcctatgta
      421 ccggccacag tccatttcat tacacccatt acttcatgcc ttaccattct ttag