Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218581 1080 bp mRNA linear INV 09-DEC-2024 (LOC123003506), mRNA. ACCESSION XM_070218581 VERSION XM_070218581.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq; includes ab initio. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1080 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1080 /gene="LOC123003506" /note="early endosome antigen 1-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:123003506" CDS 1..1080 /gene="LOC123003506" /codon_start=1 /product="early endosome antigen 1-like" /protein_id="XP_070074682.1" /db_xref="GeneID:123003506" /translation="MLKLTYFSVLLLIILVSQGSVAKSQDNGRSTCLLQDPQNQCGDF CLSKIHPMIELVPETNSKLERISREQQSIQMKLVAVQSTVEAQRITMQNSLKNITTKE EFGAKLGDTKEKLMAVIFELKNQLQLLTTKMEDQRTIKKDDFEERLNVTEEQLLVSNS ELKTQLKEMDTNARDQEISMQTKLDAQFLAVQKKLEDQNTAIFESFEERLNGTEGQIR MFDIKMEAQLKELQNKTETQLLALENQQSAFQKTLLETLSTIKFKTIDPRFKLIGSRY FYIENNIEKSWGEAAETCRRMGGYLAAFKNQEEIAAIKPKLYQSRYWTGIKRKDGKFI STASGKSAPFLKWLEGDPDHKDQET" misc_feature <166..801 /gene="LOC123003506" /note="RecF/RecN/SMC N terminal domain; Region: SMC_N; cl47134" /db_xref="CDD:481474" misc_feature 820..>1074 /gene="LOC123003506" /note="C-type lectin (CTL)/C-type lectin-like (CTLD) domain; Region: CLECT; cd00037" /db_xref="CDD:153057" ORIGIN 1 atgctgaagc tgacatattt ttctgtgctg ctccttatta tcctggtgtc tcaaggatct 61 gttgcgaaat cccaggataa tgggcgatcc acttgcctgt tgcaggaccc tcaaaatcag 121 tgtggcgact tctgccttag caagatccat ccgatgattg agttggttcc cgaaacgaat 181 tccaagttgg aaaggatctc ccgcgagcag cagtccatcc agatgaagct cgtggcagtt 241 cagtcgacgg tggaggccca aaggatcact atgcagaatt ccttgaagaa catcaccacg 301 aaagaagagt ttggcgcgaa actcggcgac acgaaggaaa aacttatggc ggtgattttt 361 gaattaaaaa accaacttca gttgctgacc acaaaaatgg aggaccaaag gaccatcaaa 421 aaggacgact ttgaggagcg attgaatgtg acggaagagc aacttttggt ctcgaattcc 481 gagttaaaga cccaactgaa ggaaatggac acgaatgcaa gagatcagga gatatccatg 541 caaaccaaac tggatgccca atttctggcg gttcagaaaa aactggagga ccagaacaca 601 gccatatttg aatcctttga agagagatta aatggaacgg agggacaaat acggatgttc 661 gacatcaaaa tggaagccca actaaaggag cttcaaaaca aaactgaaac ccaacttctg 721 gcgctggaga accaacaatc ggcctttcag aaaacccttc tcgaaaccct ttccacaatc 781 aaattcaaaa ccatcgatcc aaggttcaag cttattggct caagatattt ttatatcgaa 841 aataatattg agaaatcctg gggtgaggct gcagaaacat gtcgtagaat gggcggctat 901 ttggcggctt tcaaaaacca agaggaaatc gcagccataa agccgaaact ttaccaatct 961 cggtattgga ctggcattaa gaggaaagat ggcaagttca tatctacggc ctccggaaag 1021 tctgccccct ttttaaagtg gttagaggga gatcccgacc ataaagatca agagacataa