Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii early endosome antigen 1-like


LOCUS       XM_070218581            1080 bp    mRNA    linear   INV 09-DEC-2024
            (LOC123003506), mRNA.
ACCESSION   XM_070218581
VERSION     XM_070218581.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1080
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1080
                     /gene="LOC123003506"
                     /note="early endosome antigen 1-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:123003506"
     CDS             1..1080
                     /gene="LOC123003506"
                     /codon_start=1
                     /product="early endosome antigen 1-like"
                     /protein_id="XP_070074682.1"
                     /db_xref="GeneID:123003506"
                     /translation="MLKLTYFSVLLLIILVSQGSVAKSQDNGRSTCLLQDPQNQCGDF
                     CLSKIHPMIELVPETNSKLERISREQQSIQMKLVAVQSTVEAQRITMQNSLKNITTKE
                     EFGAKLGDTKEKLMAVIFELKNQLQLLTTKMEDQRTIKKDDFEERLNVTEEQLLVSNS
                     ELKTQLKEMDTNARDQEISMQTKLDAQFLAVQKKLEDQNTAIFESFEERLNGTEGQIR
                     MFDIKMEAQLKELQNKTETQLLALENQQSAFQKTLLETLSTIKFKTIDPRFKLIGSRY
                     FYIENNIEKSWGEAAETCRRMGGYLAAFKNQEEIAAIKPKLYQSRYWTGIKRKDGKFI
                     STASGKSAPFLKWLEGDPDHKDQET"
     misc_feature    <166..801
                     /gene="LOC123003506"
                     /note="RecF/RecN/SMC N terminal domain; Region: SMC_N;
                     cl47134"
                     /db_xref="CDD:481474"
     misc_feature    820..>1074
                     /gene="LOC123003506"
                     /note="C-type lectin (CTL)/C-type lectin-like (CTLD)
                     domain; Region: CLECT; cd00037"
                     /db_xref="CDD:153057"
ORIGIN      
        1 atgctgaagc tgacatattt ttctgtgctg ctccttatta tcctggtgtc tcaaggatct
       61 gttgcgaaat cccaggataa tgggcgatcc acttgcctgt tgcaggaccc tcaaaatcag
      121 tgtggcgact tctgccttag caagatccat ccgatgattg agttggttcc cgaaacgaat
      181 tccaagttgg aaaggatctc ccgcgagcag cagtccatcc agatgaagct cgtggcagtt
      241 cagtcgacgg tggaggccca aaggatcact atgcagaatt ccttgaagaa catcaccacg
      301 aaagaagagt ttggcgcgaa actcggcgac acgaaggaaa aacttatggc ggtgattttt
      361 gaattaaaaa accaacttca gttgctgacc acaaaaatgg aggaccaaag gaccatcaaa
      421 aaggacgact ttgaggagcg attgaatgtg acggaagagc aacttttggt ctcgaattcc
      481 gagttaaaga cccaactgaa ggaaatggac acgaatgcaa gagatcagga gatatccatg
      541 caaaccaaac tggatgccca atttctggcg gttcagaaaa aactggagga ccagaacaca
      601 gccatatttg aatcctttga agagagatta aatggaacgg agggacaaat acggatgttc
      661 gacatcaaaa tggaagccca actaaaggag cttcaaaaca aaactgaaac ccaacttctg
      721 gcgctggaga accaacaatc ggcctttcag aaaacccttc tcgaaaccct ttccacaatc
      781 aaattcaaaa ccatcgatcc aaggttcaag cttattggct caagatattt ttatatcgaa
      841 aataatattg agaaatcctg gggtgaggct gcagaaacat gtcgtagaat gggcggctat
      901 ttggcggctt tcaaaaacca agaggaaatc gcagccataa agccgaaact ttaccaatct
      961 cggtattgga ctggcattaa gaggaaagat ggcaagttca tatctacggc ctccggaaag
     1021 tctgccccct ttttaaagtg gttagaggga gatcccgacc ataaagatca agagacataa