Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218580 825 bp mRNA linear INV 09-DEC-2024 (LOC108070351), transcript variant X4, mRNA. ACCESSION XM_070218580 VERSION XM_070218580.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..825 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..825 /gene="LOC108070351" /note="uncharacterized LOC108070351; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:108070351" CDS 147..551 /gene="LOC108070351" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_070074681.1" /db_xref="GeneID:108070351" /translation="MDLKMELGGYVQSAPNTKRFVVEDSITKVTSDGEPHGMMTMVAG LSGLLAAIIILAVLVSMVACRKQRSNANRKSNSSSNVVPMTSVPQDQPQLAGNLNAAF AESTLTLDKVKDKDDGGAGDQWRPTSVVVERY" polyA_site 825 /gene="LOC108070351" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tggggcagta cggtcgaaat tcgaagtcga aattttaaaa tttgaaagtt caaaactaaa 61 ttttaaaatt ttaataccca aagtttgaaa tttttaagtt tgaaacttta ttgaaaaaaa 121 ctacatcgaa atttcgagcc cgcaacatgg acctgaaaat ggagctggga ggttacgtgc 181 aatccgcgcc caacaccaag cggttcgttg tggaggactc aattaccaag gtgacttccg 241 acggggagcc gcatggaatg atgaccatgg tggccggatt gtccggcctt ttggcggcca 301 tcatcattct ggccgttctc gtgtccatgg tggcctgtcg caagcaaagg agcaacgcca 361 accggaagag caactcctcc agcaatgtgg tgcccatgac cagtgttccg caggatcagc 421 cccagttggc gggcaatttg aacgcagcgt ttgccgagag caccctgacc ttggacaagg 481 tcaaggacaa ggacgacggg ggggcggggg accagtggcg gcccacttcc gtagtggtgg 541 agcggtacta gctgaggggt aatatatctc caaatgtata tgttatatac cccagccacc 601 ggatgggcac gtgatgtttt ttgtaaacgt ttgagactga gacttagcct aaggatttcc 661 atcaccatct tatatcttgt atcatatatg gaactatttt tttttgcttg ttaaaaatat 721 attataaaat atacacacca taagatcaga gatttaaatt gttttagaaa tttgttaaac 781 atttttaaat cgaaaaaaaa tctctaataa atatatatat tggaa