Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218567 792 bp mRNA linear INV 09-DEC-2024 (LOC123003509), mRNA. ACCESSION XM_070218567 VERSION XM_070218567.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq; includes ab initio. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..792 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..792 /gene="LOC123003509" /note="uncharacterized LOC123003509; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins" /db_xref="GeneID:123003509" CDS 1..792 /gene="LOC123003509" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_070074668.1" /db_xref="GeneID:123003509" /translation="MLRLGYFFVWVLIILNVQGFAESSQDSASAMMDLISETNSKLER IHGEQQSIQMKLLAVQSTVEAQRITVQNSLKDVITKEELGATLNETQRQLMAENAEFK NLLHLLRTKIDEQETKLDALLESKEDFVARFNDTAAQLQTILSIVAKKEYNPVEAPST NYSKPIPEQFEKIGTRYFYIERNLKKNWFEAAATCHQMGGYLAGIKSEEELLTIKTEL KEGSWYWLGINDLMTAGQFLSVASGKPAEILAWRSDSPNNERRWQ" misc_feature 529..>774 /gene="LOC123003509" /note="C-type lectin (CTL)/C-type lectin-like (CTLD) domain; Region: CLECT; cd00037" /db_xref="CDD:153057" ORIGIN 1 atgctaaggc ttggttattt ttttgtgtgg gtccttatta tcctgaatgt acaaggattc 61 gcggagagtt cgcaggacag tgcgagtgcg atgatggatc tgatttccga gaccaattct 121 aagttggaaa ggatccacgg cgagcagcag tccatccaga tgaaactcct ggcagttcag 181 tcgacggtgg aggcccaaag gatcacagtg cagaactctt tgaaggacgt catcacaaaa 241 gaagagctcg gggcgactct caatgagacc caaagacaac ttatggcgga gaatgcagaa 301 ttcaagaacc ttcttcacct gctgcgcaca aaaatagatg agcaggaaac caagctggat 361 gcccttttgg aatcgaaaga ggacttcgtg gcgagattca acgatacggc agctcaattg 421 cagacgatac tcagcatagt ggccaaaaaa gaatacaatc ctgtggaagc cccatcgacc 481 aactattcga agcccatccc cgagcagttc gagaaaattg gcacaaggta tttctatatt 541 gagaggaatc ttaagaaaaa ttggtttgaa gccgcagcca cttgccacca gatgggcggc 601 tatttagcgg gcattaaaag cgaagaggaa ttgctcacga tcaaaaccga actgaaagag 661 ggttcttggt actggcttgg catcaacgat ctgatgaccg ccggtcaatt cttatcagtt 721 gcctctggaa agccagctga aatcttggcg tggaggtccg atagtccgaa taacgagagg 781 agatggcaat aa