Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218555 954 bp mRNA linear INV 09-DEC-2024 ligase sinah (LOC138913794), mRNA. ACCESSION XM_070218555 VERSION XM_070218555.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq; includes ab initio. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..954 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..954 /gene="LOC138913794" /note="probable E3 ubiquitin-protein ligase sinah; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins" /db_xref="GeneID:138913794" CDS 1..954 /gene="LOC138913794" /codon_start=1 /product="probable E3 ubiquitin-protein ligase sinah" /protein_id="XP_070074656.1" /db_xref="GeneID:138913794" /translation="MSNQSLAAGDGTLNEFLLSQLECPICLVYMVKRIWQCENGHLIC NNCRDKVGTCPICRVELTYIRSLSMEKVASKVIFPCRFSDFGCLDRLPFADKSEHELF CKFRPFCCPFSKNNCSWRGPLMDVCRHRTQAHSDVVLKEGSEIAFEVDGITREDTERW FMMTSCHGWHFVLTLFKTEFGPQSWIFCISCRIVGEQEDADAFYFKTSLMTNGTELQR QGKVGTLGHYDTTMDVYIMVKSLDEFTSGEDDMMIKFTVIEGKMKEESQDFRAATQTG KASAGKIGGNVGLSGGGEAGGRGRGRTLDEKRLPCAMCHVP" misc_feature 55..201 /gene="LOC138913794" /note="RING finger (Really Interesting New Gene) domain and U-box domain superfamily; Region: RING_Ubox; cl17238" /db_xref="CDD:473075" misc_feature order(67..69,76..78,109..111,121..123,130..132,139..141, 160..162,169..171) /gene="LOC138913794" /note="cross-brace motif; other site" /db_xref="CDD:438410" misc_feature 190..>639 /gene="LOC138913794" /note="Seven in absentia protein family; Region: Sina; pfam03145" /db_xref="CDD:460824" ORIGIN 1 atgtcgaatc aatcattggc ggcaggggat ggaactctaa acgaattcct gctctcccag 61 ctggagtgtc ccatttgtct ggtttacatg gtgaagcgga tatggcagtg cgaaaatggt 121 cacctgattt gcaacaactg ccgcgataag gttggcacat gcccaatctg ccgggtggag 181 ctaacctata tcaggagcct ttcaatggag aaggtggcct cgaaggtgat ctttccgtgc 241 cgtttctcgg actttggctg tctggatcgg cttccatttg cggacaagtc cgagcacgag 301 ctattctgca aattccggcc gttttgctgc cctttttcga agaacaactg ctcgtggagg 361 ggacccttga tggacgtctg ccggcatcga actcaggccc acagcgacgt ggtccttaag 421 gagggcagcg agatcgcctt tgaggtggat ggtataactc gggaggacac agaacgatgg 481 ttcatgatga cttcgtgtca tgggtggcac ttcgttctca cccttttcaa gaccgagttt 541 ggcccccaat cttggatttt ctgcatatct tgccgcatcg ttggggagca ggaggatgcc 601 gatgccttct atttcaagac ctctctgatg accaatggta cagaactcca acgacaggga 661 aaagtcggaa cactaggtca ttacgacacg acaatggatg tatatattat ggtcaagtcc 721 cttgatgagt ttacctccgg ggaagacgat atgatgatta aatttaccgt cattgaaggg 781 aaaatgaagg aagagagcca agacttcagg gcggcgacac aaacagggaa agcttctgcg 841 ggaaagattg gtggaaatgt gggactatcg gggggcggcg aagcgggtgg gcgtggccgg 901 ggcaggacac tggacgagaa gcgtctgcca tgtgccatgt gccatgtgcc atga