Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii probable E3 ubiquitin-protein


LOCUS       XM_070218555             954 bp    mRNA    linear   INV 09-DEC-2024
            ligase sinah (LOC138913794), mRNA.
ACCESSION   XM_070218555
VERSION     XM_070218555.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..954
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..954
                     /gene="LOC138913794"
                     /note="probable E3 ubiquitin-protein ligase sinah; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 8 Proteins"
                     /db_xref="GeneID:138913794"
     CDS             1..954
                     /gene="LOC138913794"
                     /codon_start=1
                     /product="probable E3 ubiquitin-protein ligase sinah"
                     /protein_id="XP_070074656.1"
                     /db_xref="GeneID:138913794"
                     /translation="MSNQSLAAGDGTLNEFLLSQLECPICLVYMVKRIWQCENGHLIC
                     NNCRDKVGTCPICRVELTYIRSLSMEKVASKVIFPCRFSDFGCLDRLPFADKSEHELF
                     CKFRPFCCPFSKNNCSWRGPLMDVCRHRTQAHSDVVLKEGSEIAFEVDGITREDTERW
                     FMMTSCHGWHFVLTLFKTEFGPQSWIFCISCRIVGEQEDADAFYFKTSLMTNGTELQR
                     QGKVGTLGHYDTTMDVYIMVKSLDEFTSGEDDMMIKFTVIEGKMKEESQDFRAATQTG
                     KASAGKIGGNVGLSGGGEAGGRGRGRTLDEKRLPCAMCHVP"
     misc_feature    55..201
                     /gene="LOC138913794"
                     /note="RING finger (Really Interesting New Gene) domain
                     and U-box domain superfamily; Region: RING_Ubox; cl17238"
                     /db_xref="CDD:473075"
     misc_feature    order(67..69,76..78,109..111,121..123,130..132,139..141,
                     160..162,169..171)
                     /gene="LOC138913794"
                     /note="cross-brace motif; other site"
                     /db_xref="CDD:438410"
     misc_feature    190..>639
                     /gene="LOC138913794"
                     /note="Seven in absentia protein family; Region: Sina;
                     pfam03145"
                     /db_xref="CDD:460824"
ORIGIN      
        1 atgtcgaatc aatcattggc ggcaggggat ggaactctaa acgaattcct gctctcccag
       61 ctggagtgtc ccatttgtct ggtttacatg gtgaagcgga tatggcagtg cgaaaatggt
      121 cacctgattt gcaacaactg ccgcgataag gttggcacat gcccaatctg ccgggtggag
      181 ctaacctata tcaggagcct ttcaatggag aaggtggcct cgaaggtgat ctttccgtgc
      241 cgtttctcgg actttggctg tctggatcgg cttccatttg cggacaagtc cgagcacgag
      301 ctattctgca aattccggcc gttttgctgc cctttttcga agaacaactg ctcgtggagg
      361 ggacccttga tggacgtctg ccggcatcga actcaggccc acagcgacgt ggtccttaag
      421 gagggcagcg agatcgcctt tgaggtggat ggtataactc gggaggacac agaacgatgg
      481 ttcatgatga cttcgtgtca tgggtggcac ttcgttctca cccttttcaa gaccgagttt
      541 ggcccccaat cttggatttt ctgcatatct tgccgcatcg ttggggagca ggaggatgcc
      601 gatgccttct atttcaagac ctctctgatg accaatggta cagaactcca acgacaggga
      661 aaagtcggaa cactaggtca ttacgacacg acaatggatg tatatattat ggtcaagtcc
      721 cttgatgagt ttacctccgg ggaagacgat atgatgatta aatttaccgt cattgaaggg
      781 aaaatgaagg aagagagcca agacttcagg gcggcgacac aaacagggaa agcttctgcg
      841 ggaaagattg gtggaaatgt gggactatcg gggggcggcg aagcgggtgg gcgtggccgg
      901 ggcaggacac tggacgagaa gcgtctgcca tgtgccatgt gccatgtgcc atga