PREDICTED: Drosophila takahashii apyrase-like (LOC138913793), mRNA.

LOCUS       XM_070218549             696 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_070218549
VERSION     XM_070218549.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 69% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..696
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..696
                     /gene="LOC138913793"
                     /note="apyrase-like; Derived by automated computational
                     analysis using gene prediction method: Gnomon."
                     /db_xref="GeneID:138913793"
     CDS             19..696
                     /gene="LOC138913793"
                     /codon_start=1
                     /product="apyrase-like"
                     /protein_id="XP_070074650.1"
                     /db_xref="GeneID:138913793"
                     /translation="MEPIANRIVGQSRVYLQQSECSRGECNLGNFFTDAILYAFVKDA
                     TSSSVDDSWSNVTIAVTSQGTFRVPISAGNITYKQLFAMCPWQNRLVALTLEGKHIVE
                     LLEHGVAPMNASSASPRSSRFLQVSGLRVVFDLTLPAGQRVSSVRVRCSKCKVPEYMP
                     LVPEEKYRVVVMEYLANGKNGFGVINENAEHPEMGPFDLDALMEYMDAVGPITTGIGH
                     RIQFVNT"
     misc_feature    40..579
                     /gene="LOC138913793"
                     /note="5'-nucleotidase, C-terminal domain; Region:
                     5_nucleotid_C; pfam02872"
                     /db_xref="CDD:427027"
ORIGIN      
        1 gtgccgtggc aaatcgagat ggaacccatc gccaaccgga tcgtgggcca aagtagggtt
       61 tatctccagc agagcgagtg cagccgtggg gagtgcaatc tggggaactt cttcacggat
      121 gccatacttt atgcgttcgt caaagatgcc acttcatcgt ccgtcgatga cagttggagt
      181 aacgtgacca ttgcagtgac atcgcaggga actttccgag tgcccatttc agctggcaac
      241 atcacctaca agcaattgtt cgccatgtgc ccatggcaga atcgattggt cgcccttact
      301 ctcgagggga agcacattgt ggagcttttg gagcacggag tggcgcccat gaatgccagt
      361 tctgcatcgc cgcgatcctc gcgattcctg caggtttccg gtctacgggt cgtcttcgat
      421 ttgaccttac ccgcaggtca gcgcgtctcc agtgtccgag ttcgatgctc caaatgcaaa
      481 gtccccgaat atatgccact cgttccggaa gagaagtacc gcgtagtggt catggagtac
      541 ctggcaaatg gaaagaatgg tttcggcgta atcaacgaaa acgcagagca tcccgagatg
      601 ggtcccttcg atttggacgc attgatggag tacatggacg ccgtgggacc tattaccact
      661 ggaattggtc ataggattca gtttgtcaat acataa