Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii N-acetylglucosamine-6-phosphate


LOCUS       XM_070218548            1442 bp    mRNA    linear   INV 09-DEC-2024
            deacetylase (LOC108057280), mRNA.
ACCESSION   XM_070218548
VERSION     XM_070218548.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1442
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1442
                     /gene="LOC108057280"
                     /note="N-acetylglucosamine-6-phosphate deacetylase;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 3 Proteins"
                     /db_xref="GeneID:108057280"
     CDS             133..1353
                     /gene="LOC108057280"
                     /codon_start=1
                     /product="N-acetylglucosamine-6-phosphate deacetylase"
                     /protein_id="XP_070074649.1"
                     /db_xref="GeneID:108057280"
                     /translation="MQCTWEEKTTSGNCLLQFTNCRLVRGHRIIQEDLWVRNGRIVNP
                     EPVFFEEQVKSHRRIDCGGAIIAPGYIDLQINGGYGVDFSYDTETIEEGVATVARGLV
                     KSGVTSFCPTLVTSPNDSYHTILPRIPSEVPKGAGILGIHAEGPFINPQKKGAHPENC
                     IQTIDKGLGTLEATYGSLERLKIITLAPEKVTDREVIGQLVDRGITVALGHSMASLSD
                     GERAVQQGASLITHLFNAMLPFHHRDPGLVGLLASDAVPRGRTVYFGIIADGVHTHPA
                     ALRIAYRTHPQGLILVTDAISALGLEEGVHHIGQLPLQVKQGKAFIAGTETLCGSIAP
                     MDECVRIFQKATDCSVVYAIEAATLHPAQCLKIEDRKGTLDFGSDADFILLDDRLQVL
                     STWIAGTCVHRTAK"
     misc_feature    178..1326
                     /gene="LOC108057280"
                     /note="N-acetylglucosamine-6-phosphate deacetylase, NagA,
                     catalyzes the hydrolysis of the N-acetyl group of
                     N-acetyl-glucosamine-6-phosphate (GlcNAc-6-P) to
                     glucosamine 6-phosphate and acetate. This is the first
                     committed step in the biosynthetic pathway to...; Region:
                     NagA; cd00854"
                     /db_xref="CDD:238434"
     misc_feature    order(352..354,358..360,562..564,595..597,763..765,
                     826..828,835..840,946..948,1012..1014,1114..1116)
                     /gene="LOC108057280"
                     /note="active site"
                     /db_xref="CDD:238434"
     misc_feature    order(832..834,850..852,856..861,865..867,886..891,
                     943..954,958..963,967..972,979..981)
                     /gene="LOC108057280"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238434"
     polyA_site      1442
                     /gene="LOC108057280"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgattgataa gttcgttttt ttcgttttcg tttagtttac gtttactttc tgttgtttat
       61 ttgtgagcca tcgctcattc cgcccggatc gccagccacg ccccccgccc ccagcctcca
      121 attgacgtcc ggatgcagtg cacctgggag gagaagacga cgagcggcaa ctgcctgctg
      181 cagttcacca actgccgcct ggtacgtggc caccggatca tccaggagga tctgtgggtt
      241 cgcaacggac gcatcgtgaa tccggagccc gtcttcttcg aggagcaggt gaagtcccac
      301 aggcgcatcg attgcggagg cgccatcatc gcacccggct acatcgacct ccagatcaac
      361 ggtggctatg gcgtggactt ctcctacgac acggagacca tcgaggaggg cgtggccacg
      421 gtggctcgcg ggctggtgaa aagcggggtc acctccttct gtccaacgct ggtgacctcg
      481 ccgaacgaca gctaccacac aatactgccg cgcattccca gcgaagtgcc caagggcgcc
      541 ggcatcctgg gcatccatgc cgagggtccg ttcatcaatc cccagaagaa gggtgcgcat
      601 ccggagaact gcattcagac cattgataag ggactcggca cactggaggc cacctacggc
      661 tccttggagc gccttaagat catcaccttg gcgccggaga aggtcacgga tcgggaggta
      721 attggccagc tggtggaccg cggcatcacc gtggccctgg gccactcgat ggcctcgctg
      781 agcgacggcg aacgtgccgt tcagcagggc gcctcgctga tcacgcatct gttcaacgcc
      841 atgctgccgt tccatcaccg cgatcccggc ctggtcggac tgctcgcctc ggacgcagtg
      901 cctcgcggtc gcaccgtcta ctttggcatc attgcggatg gtgtgcacac gcatccggca
      961 gcgctgagga tcgcctatcg tacgcatccg cagggcctca tcctggtcac cgatgccatc
     1021 tcggctttgg ggttggagga gggcgtccac cacatcggac agctgcccct gcaggtgaag
     1081 cagggcaagg catttattgc cggcacggaa accctctgcg gcagcatcgc gcccatggac
     1141 gagtgcgtgc ggatcttcca aaaggccacg gattgctccg tcgtctatgc catcgaggcg
     1201 gccaccttgc atcccgccca gtgcctgaaa atcgaggatc gcaagggaac cctggacttt
     1261 ggctcggatg cggacttcat actcctggac gatcggctcc aggtgctgtc cacctggata
     1321 gcggggacat gtgttcatcg cactgccaag tagtgcaaca tatattttct attcacctga
     1381 tgcaggatgt attttatacc gaagattctc caattaaatt gttacatttt atacattcca
     1441 ca