Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218543 429 bp mRNA linear INV 09-DEC-2024 (LOC138913791), mRNA. ACCESSION XM_070218543 VERSION XM_070218543.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq; includes ab initio. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 16% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..429 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..429 /gene="LOC138913791" /note="uncharacterized LOC138913791; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:138913791" CDS 1..429 /gene="LOC138913791" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_070074644.1" /db_xref="GeneID:138913791" /translation="MSTRSSHHLVIFALALLAARSGAQPVKKGVEMELLSGKETEATT TERPHLVIEELEPMRYHFVTEHRPTSMGQNYYLKPGQLVGSVVLDSDSLQVRHEQDDG KPVASKHNILYVAYAKDLVEGPGVNNITVTNNNNGTVINN" ORIGIN 1 atgtcgacca ggtcaagtca tcatcttgtc atctttgcct tggcgctgct agctgctaga 61 agtggcgccc aaccggtgaa aaaaggagtg gaaatggagc tgctaagtgg aaaggaaaca 121 gaagcaacaa ccactgagcg accccatctc gtcatcgagg agttggaacc gatgaggtat 181 cactttgtca ccgagcatcg acccacttct atggggcaga actactatct aaaacccggg 241 cagttggtgg gaagcgtagt cctggactcg gacagcctgc aggtgcgaca cgaacaggac 301 gatggcaaac cggtggccag caagcacaac atcctctatg tggcctatgc caaggatctg 361 gtcgaaggac caggcgttaa taatattacg gttactaata ataataacgg tactgttatt 421 aataattaa