PREDICTED: Drosophila takahashii accessory gland protein

LOCUS       XM_070218541             801 bp    mRNA    linear   INV 09-DEC-2024
            Acp29AB-like (LOC138913790), mRNA.
ACCESSION   XM_070218541
VERSION     XM_070218541.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..801
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..801
                     /gene="LOC138913790"
                     /note="accessory gland protein Acp29AB-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 6 Proteins"
                     /db_xref="GeneID:138913790"
     CDS             1..801
                     /gene="LOC138913790"
                     /codon_start=1
                     /product="accessory gland protein Acp29AB-like"
                     /protein_id="XP_070074642.1"
                     /db_xref="GeneID:138913790"
                     /translation="MLLLAYFPVLAIIILQFQGSLANSTELCELFPEINFKLNRMHGE
                     QQTIKTNLLAVQSALPDSLKDMTTKEGFERQLKDHETALLSKLEVKLLEVKKKLQDQN
                     AAILESIETRSEMKSQLKELHKQIERQQEILFRIHAKNIPQKFQKFGSRYFYIENSVL
                     RNWHDAASTCRRMGGYLAGFENQEELSAIISHYKYYGIGHWFWTGINDLAEDNKFMSM
                     ASGKPATFLKWKKEPTLGKACVVLNDEHMVDKDCAHKYFFICQHDNEI"
     misc_feature    <115..>441
                     /gene="LOC138913790"
                     /note="HOOK protein coiled-coil region; Region: HOOK;
                     pfam05622"
                     /db_xref="CDD:461694"
     misc_feature    448..786
                     /gene="LOC138913790"
                     /note="C-type lectin (CTL)/C-type lectin-like (CTLD)
                     domain; Region: CLECT; cd00037"
                     /db_xref="CDD:153057"
     misc_feature    order(721..723,727..729,736..738,742..753,760..768)
                     /gene="LOC138913790"
                     /note="ligand binding surface [chemical binding]; other
                     site"
                     /db_xref="CDD:153057"
ORIGIN      
        1 atgctgctcc tggcatattt tcctgtgctg gcaattatta tcctgcagtt tcaaggatcc
       61 ttggcgaact caacggaact ctgcgaattg tttcctgaga tcaattttaa attgaaccgg
      121 atgcacggcg agcagcagac cataaaaacc aatctcctgg ctgttcaatc cgcattaccg
      181 gattccttga aggatatgac cacaaaagaa ggctttgaaa gacaactgaa ggatcatgaa
      241 actgctttac taagtaagct ggaagttaaa cttctggagg taaagaaaaa actgcaggac
      301 caaaatgcag caattttaga atccattgag acgagatcag aaatgaaatc ccaactaaag
      361 gaactgcata agcagattga gagacaacag gaaatccttt tcaggatcca cgctaaaaat
      421 atccctcaaa agttccagaa atttggttct agatatttct atatcgagaa cagtgtttta
      481 cgaaactggc acgatgcagc atctacctgc cgtcgaatgg gcggctattt ggctggtttc
      541 gaaaaccaag aagaactttc agccatcata tcacattata aatattatgg gatagggcac
      601 tggttttgga ctggcatcaa cgatttggcg gaagataaca agttcatgtc catggcctcc
      661 gggaagcctg caacatttct taagtggaag aaagaaccca cccttggtaa agcctgcgtt
      721 gtcctcaatg acgagcatat ggtggataag gattgtgctc ataaatattt tttcatttgc
      781 caacatgaca atgaaattta a