Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218512 591 bp mRNA linear INV 09-DEC-2024 (LOC138913787), mRNA. ACCESSION XM_070218512 VERSION XM_070218512.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq; includes ab initio. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..591 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..591 /gene="LOC138913787" /note="uncharacterized LOC138913787; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:138913787" CDS 1..591 /gene="LOC138913787" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_070074613.1" /db_xref="GeneID:138913787" /translation="MMANRSNIKILAQSLPTRVQAAGGSWLNLQHVAPHKSGPMITTI SNTTNTIVIRNMSIYDYLRQHLISGSKRQRSTFEPFDPLATSYPASKLRKHNFSNYQK EREREEQQRDHKKDKNHRSKGSKQSMDDYDIRFFFYLNSLILFTMSCSRQSAAEGDDL KHFICDRIRKFDRLRRKARKRRKRRPKQLAEDQMQL" ORIGIN 1 atgatggcca atagaagtaa tattaaaata ttggcccaat cgttgccaac tcgcgtgcag 61 gcggcaggcg gcagttggct taatctacag catgtggcgc cgcataaatc gggaccgatg 121 ataactacca ttagcaacac caccaacacc atcgttataa ggaacatgag catttacgac 181 tatttacggc aacacctgat aagcggttcg aagcgccagc gctcgacctt tgaacccttt 241 gatcccctgg ccacctcata tcccgcctcc aagttgcgca agcacaactt cagtaattac 301 caaaaggaga gggaaaggga ggagcaacaa agggatcaca aaaaggataa aaatcatcga 361 tccaagggct ccaaacaatc gatggatgac tacgatataa gattcttttt ctaccttaac 421 tcgctaattt tattcaccat gtcgtgcagc cggcaatcgg ccgccgaggg cgatgacctc 481 aagcacttca tttgcgaccg gatccggaag ttcgatcgtc tgcgacgaaa ggctcgaaag 541 cgccggaagc gaaggcccaa acagctggcc gaggatcaaa tgcaactctg a