PREDICTED: Drosophila takahashii uncharacterized protein

LOCUS       XM_070218506             642 bp    mRNA    linear   INV 09-DEC-2024
            (LOC138913786), mRNA.
ACCESSION   XM_070218506
VERSION     XM_070218506.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..642
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..642
                     /gene="LOC138913786"
                     /note="uncharacterized LOC138913786; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:138913786"
     CDS             1..642
                     /gene="LOC138913786"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_070074607.1"
                     /db_xref="GeneID:138913786"
                     /translation="MSNSGAFYYVRRDPKLLSTCILLRNLPNCKEKHLKRFCRTVGKV
                     LRLGIWRTYAVAQYETARKAQVAALILNGSTFKSQILTVTCSTTNFDPPMEKPYQNST
                     KEKPDFQLKKSPSSSRSSSLAKGHPDRMQKLLEILTRNLPLTESQYEEIITYLEAEKK
                     EQWKSKEPAIMYPTFEAAKRDVDLMKLVQDQRVQDALGSIYNSDVKDEIAEYL"
     misc_feature    61..249
                     /gene="LOC138913786"
                     /note="RNA recognition motif (RRM) superfamily; Region:
                     RRM_SF; cd00590"
                     /db_xref="CDD:409669"
ORIGIN      
        1 atgtccaatt ccggcgcttt ctactatgtt agaagggatc ccaagttgtt aagcacctgc
       61 atcctcctga ggaatctgcc gaattgcaaa gaaaagcacc tgaagcgctt ctgccggacg
      121 gtgggaaagg tcttgagatt agggatttgg cgcacctacg cggtcgcgca gtacgaaacg
      181 gcgcggaagg cccaggtggc tgctctgatc ctcaacggat ccaccttcaa gtcgcaaata
      241 ctgaccgtga cctgctccac taccaatttt gatccaccga tggagaagcc ctatcaaaat
      301 tccaccaagg agaagcccga tttccagctg aagaagtcgc catcctcttc ccgttctagt
      361 tcgcttgcca agggacatcc cgatcgaatg caaaagctcc tggaaatact aacacgcaat
      421 cttcctttga ccgaatcgca gtatgaggag atcatcacgt acttggaggc ggagaagaag
      481 gagcaatgga agtcgaagga accggcgatc atgtatccca ctttcgaggc cgccaagcgg
      541 gatgtggatc taatgaaact ggtgcaggat cagcgcgttc aggacgcctt ggggagcatc
      601 tacaactcgg atgtaaagga tgaaattgcc gaatacctgt ag