Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218505 1102 bp mRNA linear INV 09-DEC-2024 (Dlip1), transcript variant X1, mRNA. ACCESSION XM_070218505 VERSION XM_070218505.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1102 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1102 /gene="Dlip1" /note="Dorsal interacting protein 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108056799" CDS 172..723 /gene="Dlip1" /codon_start=1 /product="uncharacterized protein Dlip1 isoform X1" /protein_id="XP_070074606.1" /db_xref="GeneID:108056799" /translation="MDIFESFCRTCGNECPESVGIYEESVRALDKMVPLAEMLAACLP ASLPPMDPGDDYPKQICRICVKKLSLAYEFSHQWLGAHAEFNVALKFEQRRKRSLARI TQSQAQSQSQLQQSQPQDEEQLPTEAPATDVEPLKAAAPASVATTTSSSETRLGFRCG ICNESFHTEKACKFHFKFSHKDL" misc_feature 193..435 /gene="Dlip1" /note="Zinc-finger associated domain (zf-AD); Region: zf-AD; pfam07776" /db_xref="CDD:462262" ORIGIN 1 ttattggaca gagttgccag ggtatggcaa agtacagaaa aataccacaa aaataccaaa 61 gaaataccaa gatctatcgc taatcgattt ccgttgcccc acaaattata aacaaaccaa 121 ttttgaattt ttaaaaggaa tcgttaaaaa ggacacccca tcgcaatcca gatggacatc 181 ttcgagagct tctgccggac gtgcggcaac gagtgcccgg agtcggtggg catctacgag 241 gagagcgtgc gggcgctgga caagatggtg cccctggcgg agatgctggc cgcctgtctg 301 cccgcctccc tgccgccgat ggacccaggc gacgactatc ccaagcagat ctgccggatc 361 tgcgtgaaga agctgtcgct ggcctacgag ttcagccacc agtggctggg cgcccacgcc 421 gagttcaacg tggcgttgaa gttcgagcag cgcaggaagc gcagcctggc gaggattacc 481 cagtcgcagg cgcagtcgca gtcccagttg cagcaatccc agccgcagga cgaggagcag 541 ctgcccaccg aggcaccggc aacggatgtg gagcccctga aagcagctgc tcctgcgagc 601 gtcgccacca ccacgagcag cagcgaaacc aggctgggct tcaggtgcgg catctgcaac 661 gagagcttcc acacggagaa ggcctgcaag ttccacttca agttctcgca caaggatctt 721 tagtccgtct cgcccactag ctctcagttt tgtataaatg tttaagtacg ttatttgtaa 781 tagtttgtaa tgatacgccc tagcatgaga tgtaaatcac gatatcatat gcagaactta 841 tatattaatt attagtattg taaccgcgtt tctctttgta caataagata tcggctgaaa 901 tcaatcatta gatcgaattc ctccaagaat aaccatattt ctctttgtac attgcgatat 961 tatatacaga atttaaagga aacctatcat tagatcgagt tcctttaaga acaaccatat 1021 ttctccttgt acattgcgat attaaaaaca gaattaaaag gaaacccatc attagatcga 1081 gttactttaa gaagaaccat at