Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218504 1344 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_070218504 VERSION XM_070218504.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq; includes ab initio. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 1% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1344 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1344 /gene="Gr5a" /note="Gustatory receptor 5a; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:108063784" CDS 1..1269 /gene="Gr5a" /codon_start=1 /product="gustatory receptor 5a for trehalose" /protein_id="XP_070074605.1" /db_xref="GeneID:108063784" /translation="MVRVLKSRFPHRNRSNRAVHHLRSQGRIWLKHLKRGLDQCRDTQ VRGTRQNFLHNGSFHEAVAPVLVVAQCFCLMPVSGISASSYQGLSFSRRSWRFWYSVV YLCSTSVDLGFSISKVAHSVLDVRSVEPIVFHVSILIASWQFLRLARLWPGLMRHWAA VERRLPGYSCCLQRSRPARRIQLVAFLLLSLSLMEHLLSIISVVYYDFCPRRRDPVES YLHGTSAQLFAVFPYSNWLGWLGKIQNLLLTFGWSYMDIFLMVLGMGLSEMLARLNRS LELQVRQPMPEAYWTWSRTLYRSIVELIREVDDAVSGIMLISFGSNLYFICLQLLKSI NTMPSSAHAVYFYFSLMFLLSRSTAVLLFVSSINDQARIPLRLLSLVPIEGYHPEVFR FAAELACDQVALTGLKFFNVTRKLFLAAYL" misc_feature 121..1257 /gene="Gr5a" /note="7tm Chemosensory receptor; Region: 7tm_7; cl19976" /db_xref="CDD:473258" ORIGIN 1 atggtgcgag tactaaaaag ccgatttccg caccgaaatc ggtccaatcg agctgttcac 61 catcttagaa gccaaggaag gatttggctg aagcatctga aaagaggatt ggaccagtgt 121 cgagacaccc aggtgcgggg aacgcggcag aacttcctgc acaacggctc cttccatgag 181 gcagtggctc ctgttttggt cgtggcccag tgcttctgcc ttatgcccgt cagtggaatc 241 agcgcttcct cctaccaggg attgagcttc agccggcgaa gctggcgctt ttggtacagt 301 gtcgtgtacc tctgctccac ctcggtggat ctgggcttca gcatcagcaa ggtggcccac 361 agtgtcctgg atgtgcgcag tgtggagccc atagttttcc acgtgagcat tctgatcgcc 421 tcctggcagt tcctccggct ggcccgcctc tggccgggat tgatgcgcca ctgggcggcg 481 gtggagcggc ggctgcccgg ctactcctgc tgcctgcaaa ggtcccgtcc tgcccgtcgc 541 atccagttgg tggccttcct gctgctctca ctttcgctga tggagcacct gctgagcatc 601 atttcggtgg tctactacga cttctgtccg cggcgcaggg accccgtgga atcgtacctg 661 cacgggacga gtgcccagct gttcgccgtg ttcccctact ccaactggct gggctggctg 721 ggcaagatcc agaacctgct gctcaccttc ggctggagct acatggacat attcctgatg 781 gtgctgggca tggggctcag cgagatgctg gccaggctca accgcagcct ggagttgcag 841 gtgcgacagc ccatgccgga agcctactgg acctggtcgc gcactctcta ccgatcgata 901 gtggagctca tacgggaggt ggatgacgcc gtgtccggga ttatgctgat atccttcggc 961 agcaatctgt actttatctg cctgcagctg ctgaagagca tcaacacgat gccctcctcg 1021 gcccacgccg tctacttcta cttctcgctg atgttcctgc tcagtcgatc cacggccgtg 1081 ctgcttttcg tctcgtcgat caacgatcag gccaggattc cactgcgtct gctgagcctc 1141 gtgccgatcg agggctacca tccggaggtc ttccgctttg ccgcagaact ggcctgcgac 1201 caggtggcgc tcacgggcct caagttcttc aatgtcacca ggaagctgtt tctggcggct 1261 tatctctaat acattgctga gcagcagttg gcacagataa tggccattaa accatacact 1321 gtgctacaca gtcgaggagt cgag