Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Gustatory receptor 5a (Gr5a),


LOCUS       XM_070218504            1344 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_070218504
VERSION     XM_070218504.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 1% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1344
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1344
                     /gene="Gr5a"
                     /note="Gustatory receptor 5a; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 6
                     Proteins"
                     /db_xref="GeneID:108063784"
     CDS             1..1269
                     /gene="Gr5a"
                     /codon_start=1
                     /product="gustatory receptor 5a for trehalose"
                     /protein_id="XP_070074605.1"
                     /db_xref="GeneID:108063784"
                     /translation="MVRVLKSRFPHRNRSNRAVHHLRSQGRIWLKHLKRGLDQCRDTQ
                     VRGTRQNFLHNGSFHEAVAPVLVVAQCFCLMPVSGISASSYQGLSFSRRSWRFWYSVV
                     YLCSTSVDLGFSISKVAHSVLDVRSVEPIVFHVSILIASWQFLRLARLWPGLMRHWAA
                     VERRLPGYSCCLQRSRPARRIQLVAFLLLSLSLMEHLLSIISVVYYDFCPRRRDPVES
                     YLHGTSAQLFAVFPYSNWLGWLGKIQNLLLTFGWSYMDIFLMVLGMGLSEMLARLNRS
                     LELQVRQPMPEAYWTWSRTLYRSIVELIREVDDAVSGIMLISFGSNLYFICLQLLKSI
                     NTMPSSAHAVYFYFSLMFLLSRSTAVLLFVSSINDQARIPLRLLSLVPIEGYHPEVFR
                     FAAELACDQVALTGLKFFNVTRKLFLAAYL"
     misc_feature    121..1257
                     /gene="Gr5a"
                     /note="7tm Chemosensory receptor; Region: 7tm_7; cl19976"
                     /db_xref="CDD:473258"
ORIGIN      
        1 atggtgcgag tactaaaaag ccgatttccg caccgaaatc ggtccaatcg agctgttcac
       61 catcttagaa gccaaggaag gatttggctg aagcatctga aaagaggatt ggaccagtgt
      121 cgagacaccc aggtgcgggg aacgcggcag aacttcctgc acaacggctc cttccatgag
      181 gcagtggctc ctgttttggt cgtggcccag tgcttctgcc ttatgcccgt cagtggaatc
      241 agcgcttcct cctaccaggg attgagcttc agccggcgaa gctggcgctt ttggtacagt
      301 gtcgtgtacc tctgctccac ctcggtggat ctgggcttca gcatcagcaa ggtggcccac
      361 agtgtcctgg atgtgcgcag tgtggagccc atagttttcc acgtgagcat tctgatcgcc
      421 tcctggcagt tcctccggct ggcccgcctc tggccgggat tgatgcgcca ctgggcggcg
      481 gtggagcggc ggctgcccgg ctactcctgc tgcctgcaaa ggtcccgtcc tgcccgtcgc
      541 atccagttgg tggccttcct gctgctctca ctttcgctga tggagcacct gctgagcatc
      601 atttcggtgg tctactacga cttctgtccg cggcgcaggg accccgtgga atcgtacctg
      661 cacgggacga gtgcccagct gttcgccgtg ttcccctact ccaactggct gggctggctg
      721 ggcaagatcc agaacctgct gctcaccttc ggctggagct acatggacat attcctgatg
      781 gtgctgggca tggggctcag cgagatgctg gccaggctca accgcagcct ggagttgcag
      841 gtgcgacagc ccatgccgga agcctactgg acctggtcgc gcactctcta ccgatcgata
      901 gtggagctca tacgggaggt ggatgacgcc gtgtccggga ttatgctgat atccttcggc
      961 agcaatctgt actttatctg cctgcagctg ctgaagagca tcaacacgat gccctcctcg
     1021 gcccacgccg tctacttcta cttctcgctg atgttcctgc tcagtcgatc cacggccgtg
     1081 ctgcttttcg tctcgtcgat caacgatcag gccaggattc cactgcgtct gctgagcctc
     1141 gtgccgatcg agggctacca tccggaggtc ttccgctttg ccgcagaact ggcctgcgac
     1201 caggtggcgc tcacgggcct caagttcttc aatgtcacca ggaagctgtt tctggcggct
     1261 tatctctaat acattgctga gcagcagttg gcacagataa tggccattaa accatacact
     1321 gtgctacaca gtcgaggagt cgag