Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218497 1205 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_070218497 VERSION XM_070218497.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq; includes ab initio. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 1% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1205 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1205 /gene="Or92a" /note="Odorant receptor 92a; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:108055797" CDS 126..1205 /gene="Or92a" /codon_start=1 /product="putative odorant receptor 92a" /protein_id="XP_070074598.1" /db_xref="GeneID:108055797" /translation="MLFRKRKPKSDDEVVSFDDLTRFPMTFYKTIGEDLYSDRDPNVI RRYLLRFYLVLGFLNFNAYVVGEIAYFIVHIMSTTTLLEATAVAPCIGFSFMADFKQF GLTVNRKRLVKLLDDLKEIYPIDPESQAKYHVPYYRKHMNRVMTLFTILCMTYTSSFS FYPAIKSTIKYYLMGSEIFERNYGFHILFPYDAETDLTVYWFSYWGLAHCAYVAGVSY VCVDLLLITTITQLTMHFNFIADDLEAYDGGDHTDEENIKYLHDLVVYHARALDLSEE VNNIFSFLILWNFIAASLVICFAGFQITASNVEDIVLYFIFFSASLVQVFVVCYYGDE MISSVKLTDRPFGLQSKLAALQHQI" misc_feature 363..1139 /gene="Or92a" /note="7tm Odorant receptor; Region: 7tm_6; pfam02949" /db_xref="CDD:251636" ORIGIN 1 agtaattatg aggtcagcac ggcctggctg gctcatgaca atttaatggt ggagtcctgc 61 agccccctgg gtgagtccta taaaaggata aggcccagtg gatccgggga ttaaaccgca 121 tcgtcatgct gttccgcaaa cgtaagccga agtctgatga tgaggtggtc tcctttgacg 181 acctcacccg attcccgatg accttctaca agaccatcgg cgaggatctg tactcggacc 241 gggatcccaa tgtgataagg cgctatctgc tgcgattcta tctggtgctc gggttcctca 301 acttcaatgc gtatgtggtg ggcgaaatcg cgtacttcat agtgcacatc atgtcgacga 361 caactctctt ggaggccacc gccgtagcgc cgtgcattgg cttcagtttc atggccgact 421 tcaagcaatt tggactgacg gtgaatcgga agcgtttggt gaagctactc gatgatttga 481 aggagatata tcctatcgat ccggagtcgc aagcgaagta ccatgtgccg tattatagga 541 agcacatgaa cagggtcatg actttgttca ccatcctctg catgacctac acctcgtcgt 601 tcagctttta tccggccatc aagtccacca ttaagtacta cctcatgggt tcggagatct 661 ttgaacgcaa ctacggcttt cacatcctat ttccgtatga cgccgaaacg gatctcacgg 721 tctactggtt ctcctactgg ggattggctc attgtgccta tgtggctggg gtctcctacg 781 tctgcgtgga tctcctgcta atcacgacca taacccagct gactatgcac ttcaacttta 841 tagccgacga tctggaggct tacgatggcg gcgatcatac ggatgaggaa aatatcaaat 901 atctccacga tttggtcgtc tatcatgcca gagctttgga ccttagcgag gaggtgaaca 961 acatatttag cttcctgatc ctatggaact ttattgccgc ctcgttggtc atttgcttcg 1021 ctggctttca gataacagcc tccaatgtcg aggatattgt gctgtacttt atctttttct 1081 cagcctcatt ggttcaggtt tttgtggtct gctattacgg tgatgaaatg atctcctcgg 1141 tgaagctcac ggataggcca ttcggccttc aatcaaaact ggctgccctg cagcaccaaa 1201 tataa