Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Odorant receptor 92a (Or92a),


LOCUS       XM_070218497            1205 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_070218497
VERSION     XM_070218497.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 1% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1205
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1205
                     /gene="Or92a"
                     /note="Odorant receptor 92a; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 6
                     Proteins"
                     /db_xref="GeneID:108055797"
     CDS             126..1205
                     /gene="Or92a"
                     /codon_start=1
                     /product="putative odorant receptor 92a"
                     /protein_id="XP_070074598.1"
                     /db_xref="GeneID:108055797"
                     /translation="MLFRKRKPKSDDEVVSFDDLTRFPMTFYKTIGEDLYSDRDPNVI
                     RRYLLRFYLVLGFLNFNAYVVGEIAYFIVHIMSTTTLLEATAVAPCIGFSFMADFKQF
                     GLTVNRKRLVKLLDDLKEIYPIDPESQAKYHVPYYRKHMNRVMTLFTILCMTYTSSFS
                     FYPAIKSTIKYYLMGSEIFERNYGFHILFPYDAETDLTVYWFSYWGLAHCAYVAGVSY
                     VCVDLLLITTITQLTMHFNFIADDLEAYDGGDHTDEENIKYLHDLVVYHARALDLSEE
                     VNNIFSFLILWNFIAASLVICFAGFQITASNVEDIVLYFIFFSASLVQVFVVCYYGDE
                     MISSVKLTDRPFGLQSKLAALQHQI"
     misc_feature    363..1139
                     /gene="Or92a"
                     /note="7tm Odorant receptor; Region: 7tm_6; pfam02949"
                     /db_xref="CDD:251636"
ORIGIN      
        1 agtaattatg aggtcagcac ggcctggctg gctcatgaca atttaatggt ggagtcctgc
       61 agccccctgg gtgagtccta taaaaggata aggcccagtg gatccgggga ttaaaccgca
      121 tcgtcatgct gttccgcaaa cgtaagccga agtctgatga tgaggtggtc tcctttgacg
      181 acctcacccg attcccgatg accttctaca agaccatcgg cgaggatctg tactcggacc
      241 gggatcccaa tgtgataagg cgctatctgc tgcgattcta tctggtgctc gggttcctca
      301 acttcaatgc gtatgtggtg ggcgaaatcg cgtacttcat agtgcacatc atgtcgacga
      361 caactctctt ggaggccacc gccgtagcgc cgtgcattgg cttcagtttc atggccgact
      421 tcaagcaatt tggactgacg gtgaatcgga agcgtttggt gaagctactc gatgatttga
      481 aggagatata tcctatcgat ccggagtcgc aagcgaagta ccatgtgccg tattatagga
      541 agcacatgaa cagggtcatg actttgttca ccatcctctg catgacctac acctcgtcgt
      601 tcagctttta tccggccatc aagtccacca ttaagtacta cctcatgggt tcggagatct
      661 ttgaacgcaa ctacggcttt cacatcctat ttccgtatga cgccgaaacg gatctcacgg
      721 tctactggtt ctcctactgg ggattggctc attgtgccta tgtggctggg gtctcctacg
      781 tctgcgtgga tctcctgcta atcacgacca taacccagct gactatgcac ttcaacttta
      841 tagccgacga tctggaggct tacgatggcg gcgatcatac ggatgaggaa aatatcaaat
      901 atctccacga tttggtcgtc tatcatgcca gagctttgga ccttagcgag gaggtgaaca
      961 acatatttag cttcctgatc ctatggaact ttattgccgc ctcgttggtc atttgcttcg
     1021 ctggctttca gataacagcc tccaatgtcg aggatattgt gctgtacttt atctttttct
     1081 cagcctcatt ggttcaggtt tttgtggtct gctattacgg tgatgaaatg atctcctcgg
     1141 tgaagctcac ggataggcca ttcggccttc aatcaaaact ggctgccctg cagcaccaaa
     1201 tataa