Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii serine/threonine-protein kinase


LOCUS       XM_070218495            2150 bp    mRNA    linear   INV 09-DEC-2024
            phg2 (LOC108066876), mRNA.
ACCESSION   XM_070218495
VERSION     XM_070218495.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; corrected model; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio            :: 3% of CDS bases
            frameshifts          :: corrected 1 indel
            internal stop codons :: corrected 2 genomic stop codon
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-299               JARPSC010000001.1  5327848-5328146     c
            300-517             JARPSC010000001.1  5327264-5327481     c
            518-1880            JARPSC010000001.1  5318740-5320102     c
            1881-1881           "N"                1-1
            1882-2150           JARPSC010000001.1  5318471-5318739     c
FEATURES             Location/Qualifiers
     source          1..2150
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..2150
                     /gene="LOC108066876"
                     /note="serine/threonine-protein kinase phg2; The sequence
                     of the model RefSeq transcript was modified relative to
                     its source genomic sequence to represent the inferred CDS:
                     inserted 1 base in 1 codon; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108066876"
     CDS             471..2150
                     /gene="LOC108066876"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: inserted 1 base in 1 codon;
                     substituted 2 bases at 2 genomic stop codons"
                     /codon_start=1
                     /transl_except=(pos:1893..1895,aa:OTHER)
                     /transl_except=(pos:1923..1925,aa:OTHER)
                     /product="LOW QUALITY PROTEIN: serine/threonine-protein
                     kinase phg2"
                     /protein_id="XP_070074596.1"
                     /db_xref="GeneID:108066876"
                     /translation="MAHITTTHGSLSQAPRLKNRRKITAMSSNNGNDQSQAPPATATY
                     VAAAAATTTAHQEANAAAAAAAGSGSGSQVSRPATAPARSSNNNNNGSSSNTSFYTVN
                     LSNTDGSNNNTSSSSSSSNAKQASNNNHNESSTLVVNTSNTAATATATSATNNNHIYV
                     NPHSYDSSTTGSASGSTAVMLPLPLTLPLQHLPQQHLQPAAATAAATLEQQQHPLGSS
                     NTGAISRIGTSTSTTLSTLNTYLFPCGADSASSCDLDSNFSQMLGGGSEGSQATAPAG
                     SGSQSGLGLGSGLGVQLGLGFINSRRRIRRLFGVAVGNGEMVPPALAATPTPYAAALR
                     RRSSQQVLQVQQMSKKREKELEDMEQQQRIATVASANAAFLERREQQQQQQQQHLQFA
                     FNPLQLEAGKKKKKKPPGPPAHTRQQSSRTMDDPMMNRPRKNTPAVSKKKEKGPENPY
                     EKYPSPKIQIQKHPPLLSLTXKNNXIKLRENKYIXLNIMQQNKMLIFEFDLRAAILFD
                     LLACNDLNKMIKKYISLKFLSTALLYRFSTLFRLVDILLCTQSCKFYLMPM"
ORIGIN      
        1 ggataaaaat aaaaaaggac agcgggtaaa atcctacaat tgtgccattt tttttgccag
       61 tgcatttgat gatcgtgttg tgaaaaactg ataaatccga aaatcaacgt cgaatttctc
      121 gattcttgat tcccatgtga atagtgtcgc gttggtcgtt tctgttgtca ttctcgttga
      181 tgacgttgtc aatctgccct tgtccccccc tctcgctctc gctctcccct ctccctctaa
      241 caatctcggc ccctctcttt ctttagccca aaattatatg taaaattctt gagttttttt
      301 cttaagtgtt tcccgacgca aggaaagccg aagaaaaacc gaatcggtcg gaattggaaa
      361 agcaattaaa agccaagaat ccaaggaaag tagggagaag gaggaggagg tcaaagtgca
      421 actgtgcaga gcgagaaaaa gtggagtagg tcgatgaatg gatcgcctgc atggcccaca
      481 tcacgacgac gcacggcagc ttaagccaag cgccaaggct taaaaatcga cgaaaaatca
      541 cagcaatgag cagcaacaat ggcaacgatc agtcgcaagc accaccggca acagcaacat
      601 atgttgcagc tgcagcagca acaactactg cccatcagga ggccaatgca gctgcagcag
      661 cagcagcagg atcaggatca ggatcacagg tttcgcgacc tgcaacagca ccagctcgct
      721 ccagcaacaa caacaacaac ggcagcagca gcaacaccag cttttacact gtcaatctga
      781 gcaacacgga cggcagcaac aacaacacca gcagcagcag cagcagcagc aatgcgaagc
      841 aggccagcaa caacaatcac aatgagagca gcactttggt ggtcaacacc agcaatacgg
      901 ctgcaacagc aacggcaaca tcggctacca acaacaacca catctatgtg aatccgcaca
      961 gctacgacag cagcaccacc ggcagcgcca gtggctccac ggcggtgatg ttgccactgc
     1021 cactcacttt gccgctgcaa cacctgccac agcaacacct gcagccggca gcagcaacag
     1081 cagcagcaac actcgagcag cagcaacacc ctctgggcag cagcaacacg ggtgccatca
     1141 gtcgcattgg cacctccaca tccaccaccc tgagcaccct gaacacatat ctctttccct
     1201 gcggcgccga ttccgcgagc agctgcgatt tggacagcaa tttcagccag atgctcggcg
     1261 gaggaagcga aggcagccag gcaacggcac ccgcgggatc tggatcccag tcgggattgg
     1321 gactgggatc gggattgggc gtccagttgg gactgggctt catcaacagc cgacggcgca
     1381 ttcggcggct ctttggcgtg gcagtgggaa atggtgagat ggtgccgccc gctttggccg
     1441 ccacgcccac accctatgcc gccgccctgc ggcgacgcag ctcgcagcag gtgttgcagg
     1501 tgcagcagat gagcaagaag cgggaaaagg agctggagga catggagcag cagcagcgaa
     1561 tcgcaacggt ggcctcggca aatgccgctt ttctcgagcg acgcgagcag cagcagcagc
     1621 agcagcagca acatttgcag tttgccttta atcccctgca attggaggct gggaaaaaga
     1681 agaaaaagaa gccacctgga ccgcctgcac acacgagaca gcaatcgtcg cgaaccatgg
     1741 acgatcccat gatgaatcgg cccaggaaaa atacaccggc ggtcagcaag aagaaggaaa
     1801 agggacccga gaacccctat gagaagtacc catcaccaaa aatccaaatc caaaagcacc
     1861 caccgctctt aagcctcacc naaaaaaata attaaattaa attaagagag aacaaatata
     1921 tttaattaaa tattatgcag caaaacaaga tgcttatctt tgaatttgat ttacgcgctg
     1981 ccattttgtt tgatttactc gcttgtaacg atttgaataa aatgattaag aaatatatat
     2041 ctttaaaatt tttgagtacc gctttgcttt atcgcttctc aacgcttttt cgccttgttg
     2101 acattctact ttgcacccaa agttgcaaat tttatcttat gcccatgtga