Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218468 787 bp mRNA linear INV 09-DEC-2024 (LOC108068142), transcript variant X3, mRNA. ACCESSION XM_070218468 VERSION XM_070218468.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..787 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..787 /gene="LOC108068142" /note="uncharacterized LOC108068142; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108068142" CDS 435..638 /gene="LOC108068142" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_070074569.1" /db_xref="GeneID:108068142" /translation="MPAGRVAGKAGYSNHYYNGRSYVGINEEIMWVSIGMGVTIVLLI TIALCYIAREKCQKRQREYYVTA" ORIGIN 1 tcgcctccgc tgtcgcagtc ggctacttga tattccacat ctgatacatg cgcctcgccg 61 tcgctcatac gccccgttgt acgctgagaa agtgcggaaa gtgcgccaac tttcaacttg 121 ttcgaaagtg cggaatagga cgtaggacat aggatatagg cgttgtccta ggccgctttt 181 tggtgaggaa gctggcgcca cccaacgacc ttgacaactg cggaatgcag gcgaaagcac 241 ataaattgta attaaacaag ggcaaacaaa ttgaaaaagc cgaaggagaa aacaagtaga 301 aacattcgaa atagctgcaa aagcaacaaa taactcgtta aactttcctg gccagcgagc 361 caagaaaaag agtgaaacag gagaaaaaaa gcaacgcaca tttttattta ttagttggcc 421 gaacttttcg caaaatgcca gcgggtcgag tggctggcaa agccggctac tccaatcact 481 actacaacgg ccgctcgtat gtgggaatca acgaggagat catgtgggtg agcattggca 541 tgggcgtgac catcgtgctc ctgatcacga tcgccctgtg ctacattgcc cgcgagaagt 601 gccaaaagcg gcagcgggag tactacgtga ccgcatagtt gttgtacgcg gcctgcgaag 661 cgacggagga gcaggggaat cccccggatc aggtcatgga aatggaagtg gaggggaaac 721 cgactggcgt cagtcccgaa ggaggatgtc ccgaggggga ggggggaagt cccagaggag 781 caggatc