Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218451 1174 bp mRNA linear INV 09-DEC-2024 (Xrcc2), mRNA. ACCESSION XM_070218451 VERSION XM_070218451.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1174 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1174 /gene="Xrcc2" /note="X-ray repair cross complementing 2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:138911796" CDS 66..773 /gene="Xrcc2" /codon_start=1 /product="uncharacterized protein Xrcc2" /protein_id="XP_070074552.1" /db_xref="GeneID:138911796" /translation="MESSSRQLHSAVFGICGFEAETLVEISGPGDSGKSLVLQQLMAH CLAPYEFGGRQWSVLLISLSHKITRESLTRCLKAELQAAEEEKPPEDEEQLARIAADC LKRVRFLNCFTADDVSTALIDARYAIVNDPGIQLIALDTLSEFYWLDFPKRTHKLSKF RHYRLWQARLEKLCQEAIVCGMYTVDEGYLENRHGEQLPAVGISYPVRMQKILGRLTL NGLPLAFANGGVHLGDG" misc_feature 132..>593 /gene="Xrcc2" /note="Members of the P-loop NTPase domain superfamily are characterized by a conserved nucleotide phosphate-binding motif, also referred to as the Walker A motif (GxxxxGK[S/T], where x is any residue), and the Walker B motif (hhhh[D/E], where h is a...; Region: P-loop containing Nucleoside Triphosphate Hydrolases; cl38936" /db_xref="CDD:476819" misc_feature order(162..170,243..245,249..254,483..488) /gene="Xrcc2" /note="ATP binding site [chemical binding]; other site" /db_xref="CDD:410898" ORIGIN 1 ctggggcaat cgataaaagt attgtacaat tggtgggcgc aatttaagtt aaaactttta 61 tttaaatgga atcttcgtcg cgccaattgc actccgctgt ttttggaata tgcggcttcg 121 aggcggagac cctggtggag atctctggtc cgggggacag cggcaagagc ctggtgctcc 181 agcagctgat ggcccactgt ttggcgccct acgaattcgg tggccgccag tggagcgtcc 241 tcctgatcag cctgagtcac aaaatcaccc gcgagtccct gaccaggtgc ctcaaagcgg 301 agctccaagc ggccgaggag gagaagccgc cggaggatga ggagcagctg gccaggattg 361 ccgccgattg cttgaaacgc gtgcgattcc tcaactgttt caccgccgac gacgtgtcca 421 cggccctcat cgatgcccgc tatgcgatcg tcaatgatcc cggcatccag ctgattgccc 481 tcgacaccct cagcgaattc tactggctgg acttcccgaa gcggacccac aagttgtcca 541 agttccgcca ctaccggctg tggcaggcgc gtctggagaa gctctgccag gaggccatcg 601 tctgcggcat gtacaccgtg gacgagggtt acctggagaa ccgccatggc gaacagctgc 661 cggcggtcgg gataagctac ccggtcagga tgcagaagat tttggggagg ctcaccctga 721 acggattgcc actggccttt gcaaacggcg gagttcatct aggcgatggc taacaagtaa 781 gaggatcata gtcactaaca atcattaaat aacgaatata cctaagaaaa ctatcaatta 841 caacgatata tacataattt taaaataaat catccatcta taaggctaaa aaacgctcag 901 gaactcctaa aattatcatg aacataaggg gattatgatg tttaatcact tacaatcatt 961 aagtaacgat gataacttag gcaactttga aaataactaa caattacaac gatacatgca 1021 ttattttaaa ggaagtcatc catctataag gtcaaagaaa gcttaggaac tccgaaaact 1081 atcgtgaaca taagaggatt ataatatttc atgacttaca atcattaagt aacgatgata 1141 cctaaggtaa ctcaaaagat aactaataat taca