Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii X-ray repair cross complementing 2


LOCUS       XM_070218451            1174 bp    mRNA    linear   INV 09-DEC-2024
            (Xrcc2), mRNA.
ACCESSION   XM_070218451
VERSION     XM_070218451.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1174
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1174
                     /gene="Xrcc2"
                     /note="X-ray repair cross complementing 2; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:138911796"
     CDS             66..773
                     /gene="Xrcc2"
                     /codon_start=1
                     /product="uncharacterized protein Xrcc2"
                     /protein_id="XP_070074552.1"
                     /db_xref="GeneID:138911796"
                     /translation="MESSSRQLHSAVFGICGFEAETLVEISGPGDSGKSLVLQQLMAH
                     CLAPYEFGGRQWSVLLISLSHKITRESLTRCLKAELQAAEEEKPPEDEEQLARIAADC
                     LKRVRFLNCFTADDVSTALIDARYAIVNDPGIQLIALDTLSEFYWLDFPKRTHKLSKF
                     RHYRLWQARLEKLCQEAIVCGMYTVDEGYLENRHGEQLPAVGISYPVRMQKILGRLTL
                     NGLPLAFANGGVHLGDG"
     misc_feature    132..>593
                     /gene="Xrcc2"
                     /note="Members of the P-loop NTPase domain superfamily are
                     characterized by a conserved nucleotide phosphate-binding
                     motif, also referred to as the Walker A motif
                     (GxxxxGK[S/T], where x is any residue), and the Walker B
                     motif (hhhh[D/E], where h is a...; Region: P-loop
                     containing Nucleoside Triphosphate Hydrolases; cl38936"
                     /db_xref="CDD:476819"
     misc_feature    order(162..170,243..245,249..254,483..488)
                     /gene="Xrcc2"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:410898"
ORIGIN      
        1 ctggggcaat cgataaaagt attgtacaat tggtgggcgc aatttaagtt aaaactttta
       61 tttaaatgga atcttcgtcg cgccaattgc actccgctgt ttttggaata tgcggcttcg
      121 aggcggagac cctggtggag atctctggtc cgggggacag cggcaagagc ctggtgctcc
      181 agcagctgat ggcccactgt ttggcgccct acgaattcgg tggccgccag tggagcgtcc
      241 tcctgatcag cctgagtcac aaaatcaccc gcgagtccct gaccaggtgc ctcaaagcgg
      301 agctccaagc ggccgaggag gagaagccgc cggaggatga ggagcagctg gccaggattg
      361 ccgccgattg cttgaaacgc gtgcgattcc tcaactgttt caccgccgac gacgtgtcca
      421 cggccctcat cgatgcccgc tatgcgatcg tcaatgatcc cggcatccag ctgattgccc
      481 tcgacaccct cagcgaattc tactggctgg acttcccgaa gcggacccac aagttgtcca
      541 agttccgcca ctaccggctg tggcaggcgc gtctggagaa gctctgccag gaggccatcg
      601 tctgcggcat gtacaccgtg gacgagggtt acctggagaa ccgccatggc gaacagctgc
      661 cggcggtcgg gataagctac ccggtcagga tgcagaagat tttggggagg ctcaccctga
      721 acggattgcc actggccttt gcaaacggcg gagttcatct aggcgatggc taacaagtaa
      781 gaggatcata gtcactaaca atcattaaat aacgaatata cctaagaaaa ctatcaatta
      841 caacgatata tacataattt taaaataaat catccatcta taaggctaaa aaacgctcag
      901 gaactcctaa aattatcatg aacataaggg gattatgatg tttaatcact tacaatcatt
      961 aagtaacgat gataacttag gcaactttga aaataactaa caattacaac gatacatgca
     1021 ttattttaaa ggaagtcatc catctataag gtcaaagaaa gcttaggaac tccgaaaact
     1081 atcgtgaaca taagaggatt ataatatttc atgacttaca atcattaagt aacgatgata
     1141 cctaaggtaa ctcaaaagat aactaataat taca