Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii terribly reduced optic lobes


LOCUS       XM_070218444           11089 bp    mRNA    linear   INV 09-DEC-2024
            (trol), transcript variant X32, mRNA.
ACCESSION   XM_070218444
VERSION     XM_070218444.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..11089
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..11089
                     /gene="trol"
                     /note="terribly reduced optic lobes; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 7
                     Proteins"
                     /db_xref="GeneID:108055788"
     CDS             346..10416
                     /gene="trol"
                     /codon_start=1
                     /product="basement membrane-specific heparan sulfate
                     proteoglycan core protein isoform X31"
                     /protein_id="XP_070074545.1"
                     /db_xref="GeneID:108055788"
                     /translation="MDCSDGSDEIACSSLSVLPCPQHQCPSGRCYSESERCDRHRHCE
                     DGSDEANCCYADQFRCNNGDCIAESAHCDGNIDCSDQSDELDCGGDSQCLPNQFRCKN
                     GQCVSSTARCNKRSDCLDGSDEQNCANEPNNSGRGTNQLKLKTYPDNQIIKESREVIF
                     RCRDEGPNRAKVKWSRPGGRPLPPGFTDRNGRLEIPNIRVEDAGAYVCEAVGYANYIP
                     GQHVTVNLNVERLNEREIRPDSACTEYQATCMNGECIDKSGICDGHPDCSDGSDEHSC
                     SLGLKCQPNQFMCSNSKCVDRTWRCDGENDCGDNSDETSCDPEPSDAPCRYDEFQCRS
                     GHCIPKSFQCDYMNDCTDGTDEIGCSVPSPMTLPAPSIVVMEYEVLELTCVGTGVPTP
                     TIVWRLNWGHVPEKCESKSYGGTGTLRCPNMRPQDSGAYSCEFINTRGTFYPKTNSIV
                     TVTPVRSDVCKAGFFNMLARKSEECVQCFCFGVSTNCDSANLFTYAIQPPILSHRVVS
                     VELSPFRQIVINEASPGQDLLTLHHGVQFRASNVHYNGRETPFLALPAEYMGNQLKSY
                     GGNLRYEVRYNGNGRPVSGPDVIITGNSFTLTHRVRTHPGQNNRVTIPFLPGGWTKPD
                     GRKGTREDIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGSADQGLGSASLVEK
                     CTCPPGYVGDSCESCASGYVRQARGPWLGHCVPFTPEPCPAGTYGNPRLGVPCQECPC
                     PHAGANNFASGCQQSPDGDVICRCNEGYAGKRCEHCAQGYQGNPLAPGGVCRKIPDSS
                     CNVDGTYNIYSNGTCQCKDSVIGEQCDTCAPKSFHLNSFTYTGCIECFCSGVGLDCDS
                     SSWYRNQVTSTFGRTRVNHGFALISDYMRNTPVTVPVSMSTQANALSFVGSAEQAGNT
                     LYWSLPAAFLGNKLTSYGGKLSYTLSYSPLPSGIMSRNSAPDVVIKSGEDLRLIHYRK
                     SQVSPSVANTYAVEIKESAWQRGDELVPNREHVLMALSNITAIYIKATYTTSTKEASL
                     RSVTLDTATATNLGTARAVEVEQCRCPEGYLGLSCEQCAPGYTRDPEAGIYLGLCRPC
                     ECNGHSKYCNSETGECESCSDNTEGFNCDRCAAGYVGDATRGTSYDCQYDDGGYPTSR
                     PPAPGNQTAECLVNCQQEGTAGCRGYQCECKRNVAGDRCDQCRPGTYGLSAQNPDGCK
                     ECYCSGLTNQCRSASLYRQLIPVDFISTPPLITDEFGDIMDRDNLVPDVPRNVYTYKH
                     TSYTPKYWSLRGSVLGNQLLSYGGRLEYSLIVESVGRDHRGKDVVLIGNGLKLIWSRP
                     DGHDNEQEYHVRLHEDEQWTVEDRGSARQATRADFMTVLSDLQHILILATPKVPTVST
                     SISNVILESSITTRAPGATHASDIELCQCPSGYTGTSCESCAPLHYRDASGRCSQCPC
                     DASNTESCGLVSGGNVECQCRPRWRGDRCREIDTSPIIEEPPQICDLSRGFCCSGFQF
                     DIAPNETISFNDTLQIYKGNRIIGNMTKLRYGCPSRETNEPTPEPDTSTDDPVRTQII
                     VSIARPEITILPVGGSLTLSCTGRMRWTNSPVFVNWYKQGSHLPEGVEVQGGNLQLFN
                     LQISDSGIYICQAVSNETGHSFTDHVSITVSQEDQRSPAHIVDLPNDVTFEEYVSNEI
                     VCEVEGNPPPTVTWTRVDGHADAQSTRTDNNRLVFDSPRKSDEGRYRCQAENSLSREE
                     KYVVVYVRSNPPQPPPQQDRLYITPQEVNGVAGDSFQLSCQFTSAASLRYDWSHDGRS
                     LSASSPRNVVVRGNVLEVRDANVRDSGTYTCVAFDLRTRRNFTESARVYIEQPNEPGI
                     LGDKPHILTLEQNIIIVQGEDLSITCEASGTPYPSIKWTKVQENLAENVRISGNVLTI
                     YGGRSENRGLYSCIAENSHGSDQSSTSIDIEPRERPSLTIDTATQKVSVGSQASLYCA
                     AQGIPEPTVEWVRTDGQPLSPRHKVQAPGYVVIDDIVLDDSGTYECRASNIAGQVSGL
                     ATINVQEPTLVRIEPDRQHHIVTQGDELSLSCVGSGVPTPSVFWSFEGRDVDRMGVPE
                     GAVFAQPFRTNTADVKIFRVSKENEGIYVCHGSNDAGEDQQYIRVEVQPRRGDVGAGG
                     DDNGDVDTRQPPNRPQIQPNPLSNERLTTELGNNVTLICNVDNVNTEWERVDGTPLPH
                     NAYTVRNTLVIVFVEPQNLGQYRCNGIGRDGRVEAHVVRELVLLPLPRITFYPNIPLT
                     VELGQNLDVYCQVENVRPEDVHWTTDNNRPLPSSVRIEGNVLRFASITQAAAGEYRCS
                     ATNQYGSRSKNARVVVKQPSGFQPVPHSQVQQRQVGDSIQLRCRLTTQYGDEVRGNIQ
                     FNWYREDGSPLPRGVRPDSQVLQLVKLQPEDEGRYICNSYDLGSGQQLPPVSIDLQVL
                     RTTTQYPFNRFKGGVSLKDTPCMVLYICAAVPAAPQNPIYLPPVAPPRSPERILEPQL
                     SLSVQSSNLPAGDGTTVECFSSDDSYPDVVWERADGAPLSENVQQVGNNLVISNVAST
                     DAGNYVCKCKTDEGDLYTTSYKLEVEEQPHELKSSKIVYAKVGGNADLQCGADEDRQP
                     SYRWSRQYGQLQAGRSLQNEKLSLDRVQANDAGTYVCSAQYSDGETVDFPNILVVTGA
                     IPQFRQEPRSYMSFPTLSNSSFKFNFELTFRPENADGLLLFNGQTRGSGDYIALSLKD
                     RYAEFRFDFGGKPLLVRAEEPLALDEWHTVRVSRFKRDGYIQVDDQHPVAFPTSQHQQ
                     IPQLELIEDLYIGGVPNWEFLPAEAVGQQSGFVGCISRLTLQGRTVELIREAKFKEGI
                     TDCRPCAQGPCQNKGVCLESQTEQAYTCVCQPGWTGRDCAIEGTQCTAGVCGSGRCEN
                     TENDMECLCPLNRAGDRCQYNEILNEQSLNFKSNSFAAYGTPKVTKVNITLSVRPASL
                     EDSVILYTAESTLPSGDYLALVLRGGHAELLINTAARLDPVVVRSAEPLPLNRWTRIE
                     IRRRLGEGILKVGDGPERKAKAPGSDRILSLKTHLFVGGVDRSTVKINRDVNITKGFD
                     GCISKLYNSQKSVNLLGDIRDAANVQNCGEANEIDDDEYEMPVALPSPKVAENERQLM
                     APCASDPCENGGSCSEQEDMAICSCPFGFSGKHCQNHLQLSFNASFRGDGYVELNRSH
                     FQPALEQTYSHIGIVFTTNKPNGLLFWWGQEAGEEYTGQDFIAAAVVDGYVEYSMRLD
                     GEEAVIRNSDIRVDNGERHIVIAKRDENTAMLELDQILDTGDTRPTINKAMKLPGNVF
                     VGGAPDVAAFTGFRYKDNFNGCIVVVEGETVGQINLSSAAINGVNANVCPANDEPLGG
                     TEPPVV"
     misc_feature    409..501
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(412..414,436..438,469..474)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(448..450,457..459,469..471,487..492)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    478..492
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    502..606
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(517..519,541..543,574..579)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(553..555,562..564,574..576,592..597)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    583..597
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    622..726
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(637..639,661..663,694..699)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(673..675,682..684,694..696,712..717)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    703..717
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    769..975
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    1069..1173
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1084..1086,1108..1110,1141..1146)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1120..1122,1129..1131,1141..1143,1159..1164)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1150..1164
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1189..1293
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1204..1206,1228..1230,1261..1266)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1240..1242,1249..1251,1261..1263,1279..1284)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1270..1284
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1318..1422
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1333..1335,1357..1359,1390..1395)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1369..1371,1378..1380,1390..1392,1408..1413)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1399..1413
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1474..1701
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    1483..1497
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    1522..1536
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    1591..1605
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    1633..1650
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    1675..1686
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    1996..2388
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    2557..2718
                     /gene="trol"
                     /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053"
                     /db_xref="CDD:395007"
     misc_feature    order(2557..2559,2563..2565,2599..2601,2629..2631,
                     2635..2637,2662..2664)
                     /gene="trol"
                     /note="EGF-like motif [active]"
                     /db_xref="CDD:238012"
     misc_feature    2737..2850
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domai;
                     Region: EGF_Lam; smart00180"
                     /db_xref="CDD:214543"
     misc_feature    3091..3501
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    <3502..3582
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domain;
                     laminins are the major noncollagenous components of
                     basement membranes that mediate cell adhesion, growth
                     migration, and differentiation; the laminin-type epidermal
                     growth factor-like module occurs in...; Region: EGF_Lam;
                     cd00055"
                     /db_xref="CDD:238012"
     misc_feature    3604..3753
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domain;
                     laminins are the major noncollagenous components of
                     basement membranes that mediate cell adhesion, growth
                     migration, and differentiation; the laminin-type epidermal
                     growth factor-like module occurs in...; Region: EGF_Lam;
                     cd00055"
                     /db_xref="CDD:238012"
     misc_feature    order(3607..3609,3613..3615,3634..3636,3655..3657,
                     3664..3666,3691..3693)
                     /gene="trol"
                     /note="EGF-like motif [active]"
                     /db_xref="CDD:238012"
     misc_feature    <3862..3954
                     /gene="trol"
                     /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053"
                     /db_xref="CDD:395007"
     misc_feature    4150..4554
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    5017..5265
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    5050..5064
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    5098..5112
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    5155..5169
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    5197..5214
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    5242..5253
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    <5344..5505
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    5596..5847
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    5629..5643
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    5668..5682
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    5737..5751
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    5779..5796
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    5884..6126
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    5935..5949
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409570"
     misc_feature    5974..5988
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409570"
     misc_feature    6031..6045
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409570"
     misc_feature    6073..6090
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409570"
     misc_feature    6112..6123
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409570"
     misc_feature    6178..6408
                     /gene="trol"
                     /note="Immunoglobulin I-set domain; Region: I-set;
                     pfam07679"
                     /db_xref="CDD:400151"
     misc_feature    6202..6216
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    6241..6255
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    6346..6363
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    6385..6396
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    6445..6708
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    6475..6489
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    6514..6528
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    6646..6663
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    7081..7311
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    7108..7122
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    7147..7161
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    7207..7221
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    7249..7266
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    7345..>7548
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    7378..7392
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    7426..7449
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    7495..7509
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    7795..8001
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    7867..7881
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    7930..7941
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    7969..7986
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    8071..8271
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    8095..8109
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    8134..8148
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    8191..8205
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    8233..8250
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    8335..8778
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     misc_feature    8845..8943
                     /gene="trol"
                     /note="EGF-like domain; Region: EGF; pfam00008"
                     /db_xref="CDD:394967"
     misc_feature    9085..9546
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     misc_feature    9706..9804
                     /gene="trol"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    9829..10290
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     polyA_site      11089
                     /gene="trol"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ggtacagttg tgcccaagct acgatacaca tgccccaagg gcaaattcac ctgccgggac
       61 ttgagctgca tatcgattgt ccatcgctgc gatggtcggg ccgattgtcc aaacgaccga
      121 tcggatgagg agggctgtcc ctgtctgtac gacaagtggc agtgtgacga tggcacctgc
      181 atagccaagg agctgctctg caatggcaat atcgattgtc ccgaggacat ttccgatgaa
      241 cgctactgcg aggccaccac acgactaaag cccagcgact gcggtccgga tcagttcttc
      301 tgcgatgatt tatgctataa tcgctctatt cgatgcaatg gccatatgga ttgctcagat
      361 ggcagtgatg agatcgcttg tagctcgctg tcagtgcttc catgtccaca gcaccagtgt
      421 cccagtggca ggtgttattc ggaaagtgag cgatgcgatc gccacaggca ctgcgaggat
      481 ggctccgatg aggccaactg ctgttacgcg gatcaattcc gctgcaataa tggtgactgc
      541 attgcggaat cggctcattg cgatggaaat atcgattgta gcgaccagtc cgatgaactc
      601 gactgcggag gagactcgca gtgtctgccc aaccaattcc gctgcaagaa tggccaatgt
      661 gtgagctcta cagcgcgttg caacaagcgt tccgattgtt tggatggctc cgatgagcag
      721 aattgtgcca atgaacctaa caactccgga cgtggaacga accaattgaa actcaagacc
      781 tatcccgaca accaaatcat taaggagagt cgtgaggtca tcttccgttg ccgtgacgaa
      841 ggtcccaacc gcgccaaggt caagtggtcg cgacccggcg gacgtcccct gccccccggt
      901 ttcaccgatc gcaatggccg cctggagatc cccaacatca gggtggagga tgctggcgcc
      961 tatgtctgcg aggccgtggg ctatgccaac tatattcccg gtcagcacgt caccgtaaac
     1021 ctcaacgtcg agcgcttaaa cgaacgcgaa atccgtccgg actcagcctg tacggagtac
     1081 caggccacct gcatgaacgg cgagtgtatc gataagtcgg gcatctgcga tggacatccg
     1141 gactgttcgg atggctccga tgagcacagc tgcagtttgg gtttgaagtg tcagcccaac
     1201 cagttcatgt gctccaattc caagtgtgtg gatcgcacct ggcgctgtga tggcgagaac
     1261 gactgcggcg ataactccga tgagacctct tgcgatccgg aaccaagtga tgctccgtgc
     1321 cgatacgacg aattccagtg ccgcagcggt cattgcattc ccaagagctt ccagtgcgac
     1381 tatatgaacg attgtaccga tggtaccgat gaaattggat gctcggtgcc ctctccaatg
     1441 accctacccg caccctcgat tgtcgtgatg gagtacgagg tcctcgagct gacctgcgtg
     1501 ggcaccggcg tcccgacgcc gacgatcgtg tggcgtctca actggggcca tgtgcccgag
     1561 aagtgtgaat cgaagagcta cggcggaacc ggaaccctgc gctgtccgaa catgaggccc
     1621 caggacagtg gtgcctactc gtgcgagttc atcaacacac gcggcacctt ctatccgaaa
     1681 acgaactcga ttgtcaccgt tacgccggtg cgctcggatg tctgcaaggc cggattcttc
     1741 aatatgctgg cccgcaagtc ggaggaatgc gtccagtgct tctgctttgg cgtttcgacc
     1801 aactgtgaca gtgccaattt gttcacctac gccattcagc caccgatcct ttcgcaccgc
     1861 gtggtcagcg ttgaactcag tccgttccgt caaattgtca tcaatgaggc tagtccgggt
     1921 caggatctgc tcaccttgca ccatggtgtt cagttcaggg catcgaacgt acactacaac
     1981 ggccgggaga caccattctt ggccctgccc gctgagtata tgggcaacca gctgaagtcc
     2041 tatggcggca atctgcgcta cgaggtcagg tacaatggca acggtagacc ggtcagcgga
     2101 cccgatgtca tcatcaccgg caacagtttc acgctaaccc atcgcgttcg cactcatccg
     2161 ggtcagaaca acagggtgac tattcccttc ctgccgggag gctggacgaa gccggatggt
     2221 cgcaagggaa cgcgagagga catcatgatg atactggcca atgtggacaa tattctgatt
     2281 cgactgggct acctggatag cacagctcgc gaagtggatc tgataaatat cgccttggat
     2341 tcggccggaa gtgccgatca gggattgggc agtgcctcgc tcgtggagaa gtgcacctgt
     2401 ccgcccggct atgttggtga ttcgtgcgag tcctgtgcct cgggctatgt tcgccaggcc
     2461 cgcggacctt ggctgggtca ttgtgtgccc ttcaccccgg aaccgtgccc agcgggaacc
     2521 tacggcaatc cccgacttgg tgttccctgc caggagtgtc cgtgccccca cgcgggcgcc
     2581 aataactttg ccagcggctg ccaacagagt cccgatggcg atgtgatttg ccgctgcaac
     2641 gaaggctatg ccggcaagag gtgcgagcac tgcgcccagg gttaccaggg taatccgttg
     2701 gcaccgggag gagtctgtcg caagataccc gatagttcgt gcaatgtcga cggcacctac
     2761 aacatctaca gcaatggaac gtgccagtgc aaggatagcg tgattggcga acagtgcgac
     2821 acctgcgcgc cgaagagttt ccacctcaat tcgttcacct acaccggttg catcgagtgc
     2881 ttctgcagtg gagtgggctt ggattgtgac agtagttcgt ggtatcgcaa ccaggtcacc
     2941 agcacctttg gacgaacgcg cgtcaatcat ggattcgccc tgattagcga ctatatgcgc
     3001 aataccccgg taacggtgcc cgtttccatg tccacccagg ccaatgcctt gagcttcgtg
     3061 ggatccgccg agcaggccgg taatacgctc tactggagtc ttcccgccgc cttcctgggc
     3121 aacaagctga cctcgtacgg aggcaagttg agctacacgc tcagctacag tcccctgccc
     3181 agcggcatta tgtcgcgcaa cagtgccccc gatgtggtga tcaagagcgg cgaggatctg
     3241 aggctcatcc attacaggaa gtcgcaggtc agtcccagtg tggccaacac ctatgccgtg
     3301 gagatcaagg agagcgcatg gcagcgcggc gatgaactgg tgcctaaccg tgaacacgtc
     3361 ctgatggccc tcagcaatat tacggccatc tatatcaagg ccacgtacac gactagcacc
     3421 aaggaggcct cgctgcgatc ggtcacattg gatacggcca cggccaccaa tctgggcacc
     3481 gcacgtgccg tcgaagtgga gcagtgccgc tgtcccgagg gctatttggg tctctcctgc
     3541 gagcagtgtg ctcctggcta tacgcgcgat ccggaggcag gaatctatct gggtctctgc
     3601 aggccctgcg agtgcaatgg acattccaag tattgcaaca gtgagacagg cgaatgcgaa
     3661 agctgttccg acaacaccga aggattcaat tgtgaccgat gcgccgccgg ctatgtgggt
     3721 gatgccaccc gaggaacttc gtacgactgt caatacgatg acggcggcta tccgacgtcg
     3781 cgtccaccgg caccgggcaa tcagacggcc gaatgcctgg tgaattgcca acaggaggga
     3841 accgccggtt gccgcggcta ccagtgcgag tgcaagagga atgtggctgg cgatcgatgc
     3901 gatcagtgcc gccccggaac ctatggactg tcggcccaaa atccggacgg ttgcaaggag
     3961 tgctactgct ccggactgac caaccagtgc cgctcggcgt ctctctaccg ccagctgata
     4021 cccgtggact tcatttcgac gccaccattg ataacagacg aattcggcga catcatggat
     4081 agggataacc ttgtgcccga cgtgcccagg aatgtgtata cctacaagca cacctcctac
     4141 acgcccaagt actggagcct gaggggtagt gtgctgggca accagctgtt gtcgtacggc
     4201 ggccgcttgg agtacagcct gattgtggag tccgttggcc gggaccatcg tggcaaggat
     4261 gtggtcctaa ttggcaacgg actcaagctg atctggtcgc gacccgatgg ccatgacaac
     4321 gagcaggaat accatgtgcg tttgcatgag gacgagcagt ggacggttga ggatcgtgga
     4381 tcggcacgac aggccacgcg ggccgacttc atgactgtgc tgtcggatct gcagcacatc
     4441 ctgatcctgg ccacacccaa ggtgcccacg gtcagcacct cgattagcaa tgtcatcctg
     4501 gagagttcga taaccacgag agcgcctgga gctacgcatg cctccgatat cgagttgtgc
     4561 cagtgtccat ccggttatac gggcacttcc tgtgagtcct gcgcaccact gcactaccgc
     4621 gacgcctctg gacgctgcag tcagtgtcct tgcgacgctt ccaacacgga atcctgcggc
     4681 ttggtcagcg gcggtaacgt cgaatgccag tgcaggccac gctggagggg tgatcgctgc
     4741 cgggaaattg acacatcgcc cattatcgaa gaaccgcccc agatatgtga tttaagcagg
     4801 ggattctgtt gcagcggctt tcagttcgat atcgcaccga acgagacaat ctcgtttaat
     4861 gacaccctgc agatatataa gggcaacaga atcataggaa atatgaccaa gctgcgctac
     4921 ggctgtccat cgcgagaaac taacgaaccg actccggaac cggataccag taccgatgat
     4981 cccgtgcgca cccagatcat agtgtcgatt gccaggccag agattaccat tctgcccgtg
     5041 ggtggatcgc tgaccctcag ctgtaccggt cgaatgcgct ggaccaatag cccagtgttt
     5101 gtgaactggt acaagcaggg cagtcacctg cccgagggag tcgaggtgca aggcggtaat
     5161 ctgcagctgt tcaacctgca gatcagcgat tctggaatct acatctgcca ggccgtaagc
     5221 aacgagaccg gccacagctt tacggaccac gtctccatca ccgtttccca ggaggaccaa
     5281 cgctcgccgg ctcacattgt ggatttgccc aacgacgtga ccttcgagga gtacgtaagc
     5341 aatgagatcg tctgcgaggt ggagggcaac ccaccaccca ctgtcacctg gactcgcgtg
     5401 gatggccatg cggacgccca aagtacgcga acggacaaca atcggctggt cttcgattcg
     5461 ccgaggaaat cggacgaggg tcgctatcgc tgccaggcag agaatagcct gagtcgggag
     5521 gagaagtacg tagtcgtgta tgtccggagc aatcctcccc agccgccgcc gcagcaggat
     5581 cgtttgtaca tcacaccgca ggaggtgaac ggtgtggccg gtgactcctt ccagttgtcc
     5641 tgccaattca ccagcgctgc ctctctgcgc tacgattggt cccacgatgg tcgctccctg
     5701 tccgcgtcgt caccccgaaa tgttgtggtc cgcggaaatg tcctggaagt ccgcgatgcc
     5761 aacgttcgcg actccggcac ctacacctgt gtggccttcg acctgcgcac ccgacgcaac
     5821 ttcaccgaga gcgcacgggt ctacatcgag cagcccaacg agccgggaat ccttggcgac
     5881 aagccgcata tcttgacctt ggagcagaac atcataattg tgcaaggcga ggacttgagc
     5941 atcacatgtg aggcaagtgg aacgccctat ccctcgatta agtggaccaa ggtgcaggag
     6001 aatctggccg aaaatgtccg catcagtggc aatgtgctca ccatctacgg aggccgcagt
     6061 gagaatcgtg gtctttactc ctgcatcgcc gagaactctc acggcagcga tcagtccagc
     6121 acaagcatcg atattgaacc ccgggagcgg ccgagtctta cgattgatac ggccacccaa
     6181 aaggtttcgg ttggctccca ggcgtccctt tactgtgccg cccagggcat tcccgaaccg
     6241 accgtcgagt gggttcgaac ggatggtcag ccactgtcgc cgcgtcacaa ggtccaggca
     6301 cccggctatg ttgtgatcga tgacattgtg ctcgatgata gcggtaccta cgagtgccgg
     6361 gcgagcaaca tagctggcca ggtgagcggc ttggccacca ttaacgtcca ggagccaact
     6421 cttgtgcgga tcgaaccaga taggcaacac catatcgtca cccagggcga cgaactctcg
     6481 ctcagctgcg tgggcagtgg cgtccctact ccttcggtct tttggagttt cgagggaaga
     6541 gacgttgaca ggatgggagt accggaaggt gctgtttttg cgcaaccttt ccgaaccaac
     6601 actgccgacg tgaaaatctt ccgggtgagc aaggagaacg aaggcatcta cgtctgtcac
     6661 ggatccaatg acgcgggtga agatcaacaa tacattcgcg tggaggtaca acccagacgg
     6721 ggtgacgtcg gtgcaggagg agatgacaat ggtgatgtcg atacccgaca gccccccaat
     6781 cggccccaaa tccaaccgaa tccattgagc aacgaacgcc tgaccaccga attgggcaac
     6841 aatgtgaccc tcatctgcaa cgtggacaac gtgaacacgg aatgggaacg cgtcgatggc
     6901 acacccctgc cgcacaatgc ctacacggtg agaaatacgc tggtgattgt cttcgtggag
     6961 ccgcagaatc tgggtcagta ccgctgcaat ggaatcggtc gcgatggacg tgtggaggcc
     7021 catgtggtga gggagctggt tctcctgccc ctgcccagga tcaccttcta tcccaacatc
     7081 ccgctgaccg tggagctggg ccagaacttg gatgtctact gccaggtgga gaacgtgcgt
     7141 ccggaggacg tgcattggac caccgacaac aatcgaccac tgcccagttc cgtacgcatc
     7201 gagggcaatg tcctcaggtt cgcgtccatc actcaggctg ctgccggtga ataccgctgc
     7261 tcggccacca atcaatatgg aagccgatcg aagaacgcca gggtggtggt gaaacagccc
     7321 agtggcttcc agcccgttcc ccactcgcag gtgcaacagc gtcaggtggg cgactccatc
     7381 cagttgcgat gccgcctgac cacccagtac ggcgacgagg ttcgcggcaa tatccagttc
     7441 aactggtacc gtgaggacgg cagccccttg ccccgcggtg tccgtccgga tagccaggtg
     7501 ctgcagctgg ttaaattgca gcccgaggac gagggccgct acatctgcaa ctcgtacgat
     7561 ttgggcagcg ggcagcaact gccccccgtc tccatcgact tgcaagtact aagaactact
     7621 acccagtatc ctttcaatcg gtttaagggc ggtgtctccc tgaaagacac gccctgcatg
     7681 gttctgtata tttgtgcagc ggtaccagcg gctccccaga accccatcta cctgccgcca
     7741 gtggcgccac cacgttcgcc cgaaaggatc ctcgagcccc aactgagcct gagtgtacaa
     7801 tcctcgaacc tgccagccgg cgacggcacc accgtcgagt gcttctcctc cgatgactcc
     7861 tacccagatg tcgtgtggga acgcgccgat ggagctccac tcagcgaaaa tgtccagcaa
     7921 gtgggcaata acctggtgat tagtaacgtg gcctccaccg atgccggtaa ctatgtgtgc
     7981 aagtgcaaga cggacgaggg agatctgtat accaccagct acaaactgga ggtcgaggag
     8041 cagccccatg aactgaagag ctccaagata gtctacgcca aggttggcgg aaatgccgac
     8101 ttgcagtgcg gagccgatga agatcgacag cccagctacc gttggtctcg ccaatacgga
     8161 caacttcagg cgggacgcag tctgcagaat gagaaacttt cgttggatcg cgttcaggcc
     8221 aacgatgccg gaacttatgt ttgttcggcc caatacagcg atggcgagac ggttgacttc
     8281 cccaacattc tggttgtgac cggggcgatt ccccagttcc gccaggagcc ccgcagctac
     8341 atgagcttcc ccacgctctc gaactcctcg ttcaagttca acttcgagct gaccttccgg
     8401 ccggaaaacg ccgacggact gctgctcttc aatggacaga cccgcggaag cggtgactat
     8461 atcgcactct cgctgaagga tcgctatgcg gagttccggt tcgattttgg cggtaaaccg
     8521 ttgctggtgc gagcggagga gccactggct ttggatgaat ggcacacggt gcgcgtgagt
     8581 cgcttcaagc gggatggcta catccaggtg gacgaccagc atccggtggc cttccccacc
     8641 tcccagcatc agcagatacc ccagttggaa ctgattgagg atctgtacat tggcggcgtg
     8701 cccaactggg agttcctgcc cgccgaggcg gtgggtcagc aatcaggctt cgtgggctgc
     8761 attagccggc tgaccctgca gggacgcacc gtggagctga tccgggaggc caagttcaag
     8821 gagggcatca ccgattgccg gccctgcgcc cagggaccct gccagaacaa gggcgtctgc
     8881 ctggagagcc agacggagca ggcctacacc tgcgtctgcc agccgggctg gactggccgg
     8941 gattgtgcca tcgagggcac ccagtgcacc gcaggagttt gcggctcggg acgctgcgag
     9001 aatacggaga acgacatgga gtgcctgtgc ccgctgaaca gggcaggcga tcgatgccag
     9061 tacaatgaga ttctaaatga acagagcttg aatttcaaga gcaacagctt tgcggcctac
     9121 ggaactccca aggtcaccaa agtaaacatc acactctccg ttcgtcccgc gagcctggag
     9181 gactctgtga tcctgtacac ggcggaatcc actctgccca gcggcgatta cctggctttg
     9241 gtccttcgcg gtggccacgc ggagctgctg atcaacacgg ccgcccgctt ggatcccgtg
     9301 gtggtgcgtt cggcggaacc gctgcccctc aatcgctgga ccagaatcga gatcaggcgt
     9361 cgcctgggcg agggaatcct caaggtgggc gatggacccg agcgaaaggc caaggcaccg
     9421 ggatccgatc gcattctgtc gctcaagacc cacctctttg tgggcggcgt cgatcggtcg
     9481 accgtaaaga tcaaccgtga tgtgaacatc accaagggct tcgatggctg catctcgaag
     9541 ctgtacaact cgcagaaatc cgtcaatctg ctgggtgaca tcagggatgc ggcgaatgtc
     9601 cagaactgtg gggaggcgaa tgagatagat gacgatgagt atgagatgcc agtagcgctg
     9661 ccatcgccta aggtcgccga gaatgaacgt cagctgatgg cgccgtgtgc cagtgatccc
     9721 tgcgagaacg ggggaagctg cagcgagcag gaggacatgg ccatctgctc ctgtcccttc
     9781 ggcttcagcg gcaaacactg ccagaatcac ctccagctga gcttcaatgc ctcgttccgc
     9841 ggcgatggct acgtggagct gaaccgcagc cacttccaac ccgccctgga gcagacgtac
     9901 tcccacattg gcattgtgtt caccaccaac aagccgaatg gcctgctttt ctggtggggc
     9961 caggaggccg gggaggagta caccggacag gacttcattg ccgccgccgt ggtcgatggc
    10021 tatgtggagt actcgatgag gctcgatggc gaggaggcgg tcattcggaa cagcgatatc
    10081 cgcgtggaca atggcgagcg gcacattgtg atcgccaagc gggatgagaa caccgccatg
    10141 ctggaactcg atcagatcct ggacacgggc gatacgcgac ccaccatcaa caaggcaatg
    10201 aagctgccgg gcaatgtgtt tgtcggtggc gctcctgatg tcgcggcatt cacgggcttc
    10261 cgctacaagg acaatttcaa cggctgcatt gtggtcgtcg agggcgaaac cgtgggccaa
    10321 attaacctta gttcagctgc catcaatgga gtgaatgcca acgtgtgtcc cgctaacgac
    10381 gaacctctgg gaggaaccga accgccagtc gtctgaggac acaaccagca accgaaatta
    10441 gctttttaat taaacattaa caaatgaaac aaaaagaaaa acaattttta tatatacaac
    10501 atatgaataa gccccaagca aacctacaaa aaattgaata ttatacgacg aacagataat
    10561 ataaaaacaa aaaaagagag aaacgatcac ttctactaca attgcttctt cgatccttaa
    10621 gtctaggtta aagattgtag caagaaaaca agcgaatatc acaaacattt atttaacaag
    10681 aacgccatgc gagaagtgaa acgaaacaga aacaataatg caattaatgc agataataca
    10741 gataaagcct agaaccctaa gaactaacta actaactcga acaagaacaa caacgcatac
    10801 tagccaactg caaccacaac aaccacaata gtgaaggcat tttaattata attttagtct
    10861 ctagcttata actatgacta cgactcgttt tttttgtgag cccagtgtaa aatgttggaa
    10921 atcggaaatt ggccctacac acaaacacac acaagttatt aattaaatac caattgatac
    10981 catataatga taaatgaaat actatgaatg caactattgt gaacgaacga aaaccgttga
    11041 gtggataaaa agcataagca gaagatatat taaaatgaaa tcaacaaca