Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218444 11089 bp mRNA linear INV 09-DEC-2024 (trol), transcript variant X32, mRNA. ACCESSION XM_070218444 VERSION XM_070218444.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..11089 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..11089 /gene="trol" /note="terribly reduced optic lobes; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:108055788" CDS 346..10416 /gene="trol" /codon_start=1 /product="basement membrane-specific heparan sulfate proteoglycan core protein isoform X31" /protein_id="XP_070074545.1" /db_xref="GeneID:108055788" /translation="MDCSDGSDEIACSSLSVLPCPQHQCPSGRCYSESERCDRHRHCE DGSDEANCCYADQFRCNNGDCIAESAHCDGNIDCSDQSDELDCGGDSQCLPNQFRCKN GQCVSSTARCNKRSDCLDGSDEQNCANEPNNSGRGTNQLKLKTYPDNQIIKESREVIF RCRDEGPNRAKVKWSRPGGRPLPPGFTDRNGRLEIPNIRVEDAGAYVCEAVGYANYIP GQHVTVNLNVERLNEREIRPDSACTEYQATCMNGECIDKSGICDGHPDCSDGSDEHSC SLGLKCQPNQFMCSNSKCVDRTWRCDGENDCGDNSDETSCDPEPSDAPCRYDEFQCRS GHCIPKSFQCDYMNDCTDGTDEIGCSVPSPMTLPAPSIVVMEYEVLELTCVGTGVPTP TIVWRLNWGHVPEKCESKSYGGTGTLRCPNMRPQDSGAYSCEFINTRGTFYPKTNSIV TVTPVRSDVCKAGFFNMLARKSEECVQCFCFGVSTNCDSANLFTYAIQPPILSHRVVS VELSPFRQIVINEASPGQDLLTLHHGVQFRASNVHYNGRETPFLALPAEYMGNQLKSY GGNLRYEVRYNGNGRPVSGPDVIITGNSFTLTHRVRTHPGQNNRVTIPFLPGGWTKPD GRKGTREDIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGSADQGLGSASLVEK CTCPPGYVGDSCESCASGYVRQARGPWLGHCVPFTPEPCPAGTYGNPRLGVPCQECPC PHAGANNFASGCQQSPDGDVICRCNEGYAGKRCEHCAQGYQGNPLAPGGVCRKIPDSS CNVDGTYNIYSNGTCQCKDSVIGEQCDTCAPKSFHLNSFTYTGCIECFCSGVGLDCDS SSWYRNQVTSTFGRTRVNHGFALISDYMRNTPVTVPVSMSTQANALSFVGSAEQAGNT LYWSLPAAFLGNKLTSYGGKLSYTLSYSPLPSGIMSRNSAPDVVIKSGEDLRLIHYRK SQVSPSVANTYAVEIKESAWQRGDELVPNREHVLMALSNITAIYIKATYTTSTKEASL RSVTLDTATATNLGTARAVEVEQCRCPEGYLGLSCEQCAPGYTRDPEAGIYLGLCRPC ECNGHSKYCNSETGECESCSDNTEGFNCDRCAAGYVGDATRGTSYDCQYDDGGYPTSR PPAPGNQTAECLVNCQQEGTAGCRGYQCECKRNVAGDRCDQCRPGTYGLSAQNPDGCK ECYCSGLTNQCRSASLYRQLIPVDFISTPPLITDEFGDIMDRDNLVPDVPRNVYTYKH TSYTPKYWSLRGSVLGNQLLSYGGRLEYSLIVESVGRDHRGKDVVLIGNGLKLIWSRP DGHDNEQEYHVRLHEDEQWTVEDRGSARQATRADFMTVLSDLQHILILATPKVPTVST SISNVILESSITTRAPGATHASDIELCQCPSGYTGTSCESCAPLHYRDASGRCSQCPC DASNTESCGLVSGGNVECQCRPRWRGDRCREIDTSPIIEEPPQICDLSRGFCCSGFQF DIAPNETISFNDTLQIYKGNRIIGNMTKLRYGCPSRETNEPTPEPDTSTDDPVRTQII VSIARPEITILPVGGSLTLSCTGRMRWTNSPVFVNWYKQGSHLPEGVEVQGGNLQLFN LQISDSGIYICQAVSNETGHSFTDHVSITVSQEDQRSPAHIVDLPNDVTFEEYVSNEI VCEVEGNPPPTVTWTRVDGHADAQSTRTDNNRLVFDSPRKSDEGRYRCQAENSLSREE KYVVVYVRSNPPQPPPQQDRLYITPQEVNGVAGDSFQLSCQFTSAASLRYDWSHDGRS LSASSPRNVVVRGNVLEVRDANVRDSGTYTCVAFDLRTRRNFTESARVYIEQPNEPGI LGDKPHILTLEQNIIIVQGEDLSITCEASGTPYPSIKWTKVQENLAENVRISGNVLTI YGGRSENRGLYSCIAENSHGSDQSSTSIDIEPRERPSLTIDTATQKVSVGSQASLYCA AQGIPEPTVEWVRTDGQPLSPRHKVQAPGYVVIDDIVLDDSGTYECRASNIAGQVSGL ATINVQEPTLVRIEPDRQHHIVTQGDELSLSCVGSGVPTPSVFWSFEGRDVDRMGVPE GAVFAQPFRTNTADVKIFRVSKENEGIYVCHGSNDAGEDQQYIRVEVQPRRGDVGAGG DDNGDVDTRQPPNRPQIQPNPLSNERLTTELGNNVTLICNVDNVNTEWERVDGTPLPH NAYTVRNTLVIVFVEPQNLGQYRCNGIGRDGRVEAHVVRELVLLPLPRITFYPNIPLT VELGQNLDVYCQVENVRPEDVHWTTDNNRPLPSSVRIEGNVLRFASITQAAAGEYRCS ATNQYGSRSKNARVVVKQPSGFQPVPHSQVQQRQVGDSIQLRCRLTTQYGDEVRGNIQ FNWYREDGSPLPRGVRPDSQVLQLVKLQPEDEGRYICNSYDLGSGQQLPPVSIDLQVL RTTTQYPFNRFKGGVSLKDTPCMVLYICAAVPAAPQNPIYLPPVAPPRSPERILEPQL SLSVQSSNLPAGDGTTVECFSSDDSYPDVVWERADGAPLSENVQQVGNNLVISNVAST DAGNYVCKCKTDEGDLYTTSYKLEVEEQPHELKSSKIVYAKVGGNADLQCGADEDRQP SYRWSRQYGQLQAGRSLQNEKLSLDRVQANDAGTYVCSAQYSDGETVDFPNILVVTGA IPQFRQEPRSYMSFPTLSNSSFKFNFELTFRPENADGLLLFNGQTRGSGDYIALSLKD RYAEFRFDFGGKPLLVRAEEPLALDEWHTVRVSRFKRDGYIQVDDQHPVAFPTSQHQQ IPQLELIEDLYIGGVPNWEFLPAEAVGQQSGFVGCISRLTLQGRTVELIREAKFKEGI TDCRPCAQGPCQNKGVCLESQTEQAYTCVCQPGWTGRDCAIEGTQCTAGVCGSGRCEN TENDMECLCPLNRAGDRCQYNEILNEQSLNFKSNSFAAYGTPKVTKVNITLSVRPASL EDSVILYTAESTLPSGDYLALVLRGGHAELLINTAARLDPVVVRSAEPLPLNRWTRIE IRRRLGEGILKVGDGPERKAKAPGSDRILSLKTHLFVGGVDRSTVKINRDVNITKGFD GCISKLYNSQKSVNLLGDIRDAANVQNCGEANEIDDDEYEMPVALPSPKVAENERQLM APCASDPCENGGSCSEQEDMAICSCPFGFSGKHCQNHLQLSFNASFRGDGYVELNRSH FQPALEQTYSHIGIVFTTNKPNGLLFWWGQEAGEEYTGQDFIAAAVVDGYVEYSMRLD GEEAVIRNSDIRVDNGERHIVIAKRDENTAMLELDQILDTGDTRPTINKAMKLPGNVF VGGAPDVAAFTGFRYKDNFNGCIVVVEGETVGQINLSSAAINGVNANVCPANDEPLGG TEPPVV" misc_feature 409..501 /gene="trol" /note="Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about...; Region: LDLa; cd00112" /db_xref="CDD:238060" misc_feature order(412..414,436..438,469..474) /gene="trol" /note="putative binding surface [active]" /db_xref="CDD:238060" misc_feature order(448..450,457..459,469..471,487..492) /gene="trol" /note="calcium-binding site [ion binding]; other site" /db_xref="CDD:238060" misc_feature 478..492 /gene="trol" /note="D-X-S-D-E motif; other site" /db_xref="CDD:238060" misc_feature 502..606 /gene="trol" /note="Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about...; Region: LDLa; cd00112" /db_xref="CDD:238060" misc_feature order(517..519,541..543,574..579) /gene="trol" /note="putative binding surface [active]" /db_xref="CDD:238060" misc_feature order(553..555,562..564,574..576,592..597) /gene="trol" /note="calcium-binding site [ion binding]; other site" /db_xref="CDD:238060" misc_feature 583..597 /gene="trol" /note="D-X-S-D-E motif; other site" /db_xref="CDD:238060" misc_feature 622..726 /gene="trol" /note="Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about...; Region: LDLa; cd00112" /db_xref="CDD:238060" misc_feature order(637..639,661..663,694..699) /gene="trol" /note="putative binding surface [active]" /db_xref="CDD:238060" misc_feature order(673..675,682..684,694..696,712..717) /gene="trol" /note="calcium-binding site [ion binding]; other site" /db_xref="CDD:238060" misc_feature 703..717 /gene="trol" /note="D-X-S-D-E motif; other site" /db_xref="CDD:238060" misc_feature 769..975 /gene="trol" /note="Immunoglobulin domain; Region: Ig_3; pfam13927" /db_xref="CDD:464046" misc_feature 1069..1173 /gene="trol" /note="Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about...; Region: LDLa; cd00112" /db_xref="CDD:238060" misc_feature order(1084..1086,1108..1110,1141..1146) /gene="trol" /note="putative binding surface [active]" /db_xref="CDD:238060" misc_feature order(1120..1122,1129..1131,1141..1143,1159..1164) /gene="trol" /note="calcium-binding site [ion binding]; other site" /db_xref="CDD:238060" misc_feature 1150..1164 /gene="trol" /note="D-X-S-D-E motif; other site" /db_xref="CDD:238060" misc_feature 1189..1293 /gene="trol" /note="Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about...; Region: LDLa; cd00112" /db_xref="CDD:238060" misc_feature order(1204..1206,1228..1230,1261..1266) /gene="trol" /note="putative binding surface [active]" /db_xref="CDD:238060" misc_feature order(1240..1242,1249..1251,1261..1263,1279..1284) /gene="trol" /note="calcium-binding site [ion binding]; other site" /db_xref="CDD:238060" misc_feature 1270..1284 /gene="trol" /note="D-X-S-D-E motif; other site" /db_xref="CDD:238060" misc_feature 1318..1422 /gene="trol" /note="Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about...; Region: LDLa; cd00112" /db_xref="CDD:238060" misc_feature order(1333..1335,1357..1359,1390..1395) /gene="trol" /note="putative binding surface [active]" /db_xref="CDD:238060" misc_feature order(1369..1371,1378..1380,1390..1392,1408..1413) /gene="trol" /note="calcium-binding site [ion binding]; other site" /db_xref="CDD:238060" misc_feature 1399..1413 /gene="trol" /note="D-X-S-D-E motif; other site" /db_xref="CDD:238060" misc_feature 1474..1701 /gene="trol" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 1483..1497 /gene="trol" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 1522..1536 /gene="trol" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 1591..1605 /gene="trol" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 1633..1650 /gene="trol" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 1675..1686 /gene="trol" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 1996..2388 /gene="trol" /note="Laminin B (Domain IV); Region: Laminin_B; pfam00052" /db_xref="CDD:459652" misc_feature 2557..2718 /gene="trol" /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053" /db_xref="CDD:395007" misc_feature order(2557..2559,2563..2565,2599..2601,2629..2631, 2635..2637,2662..2664) /gene="trol" /note="EGF-like motif [active]" /db_xref="CDD:238012" misc_feature 2737..2850 /gene="trol" /note="Laminin-type epidermal growth factor-like domai; Region: EGF_Lam; smart00180" /db_xref="CDD:214543" misc_feature 3091..3501 /gene="trol" /note="Laminin B (Domain IV); Region: Laminin_B; pfam00052" /db_xref="CDD:459652" misc_feature <3502..3582 /gene="trol" /note="Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in...; Region: EGF_Lam; cd00055" /db_xref="CDD:238012" misc_feature 3604..3753 /gene="trol" /note="Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in...; Region: EGF_Lam; cd00055" /db_xref="CDD:238012" misc_feature order(3607..3609,3613..3615,3634..3636,3655..3657, 3664..3666,3691..3693) /gene="trol" /note="EGF-like motif [active]" /db_xref="CDD:238012" misc_feature <3862..3954 /gene="trol" /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053" /db_xref="CDD:395007" misc_feature 4150..4554 /gene="trol" /note="Laminin B (Domain IV); Region: Laminin_B; pfam00052" /db_xref="CDD:459652" misc_feature 5017..5265 /gene="trol" /note="Immunoglobulin like; Region: IG_like; smart00410" /db_xref="CDD:214653" misc_feature 5050..5064 /gene="trol" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 5098..5112 /gene="trol" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 5155..5169 /gene="trol" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 5197..5214 /gene="trol" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 5242..5253 /gene="trol" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature <5344..5505 /gene="trol" /note="Immunoglobulin domain; Region: Ig_3; pfam13927" /db_xref="CDD:464046" misc_feature 5596..5847 /gene="trol" /note="Immunoglobulin like; Region: IG_like; smart00410" /db_xref="CDD:214653" misc_feature 5629..5643 /gene="trol" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 5668..5682 /gene="trol" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 5737..5751 /gene="trol" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 5779..5796 /gene="trol" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 5884..6126 /gene="trol" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 5935..5949 /gene="trol" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409570" misc_feature 5974..5988 /gene="trol" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409570" misc_feature 6031..6045 /gene="trol" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409570" misc_feature 6073..6090 /gene="trol" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409570" misc_feature 6112..6123 /gene="trol" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409570" misc_feature 6178..6408 /gene="trol" /note="Immunoglobulin I-set domain; Region: I-set; pfam07679" /db_xref="CDD:400151" misc_feature 6202..6216 /gene="trol" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 6241..6255 /gene="trol" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 6346..6363 /gene="trol" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 6385..6396 /gene="trol" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 6445..6708 /gene="trol" /note="Immunoglobulin like; Region: IG_like; smart00410" /db_xref="CDD:214653" misc_feature 6475..6489 /gene="trol" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 6514..6528 /gene="trol" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 6646..6663 /gene="trol" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 7081..7311 /gene="trol" /note="Immunoglobulin like; Region: IG_like; smart00410" /db_xref="CDD:214653" misc_feature 7108..7122 /gene="trol" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 7147..7161 /gene="trol" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 7207..7221 /gene="trol" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 7249..7266 /gene="trol" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 7345..>7548 /gene="trol" /note="Immunoglobulin like; Region: IG_like; smart00410" /db_xref="CDD:214653" misc_feature 7378..7392 /gene="trol" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 7426..7449 /gene="trol" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 7495..7509 /gene="trol" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 7795..8001 /gene="trol" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 7867..7881 /gene="trol" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 7930..7941 /gene="trol" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 7969..7986 /gene="trol" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 8071..8271 /gene="trol" /note="Immunoglobulin like; Region: IG_like; smart00410" /db_xref="CDD:214653" misc_feature 8095..8109 /gene="trol" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 8134..8148 /gene="trol" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 8191..8205 /gene="trol" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 8233..8250 /gene="trol" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 8335..8778 /gene="trol" /note="Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans. Proteins that contain LamG domains serve a variety of...; Region: LamG; cd00110" /db_xref="CDD:238058" misc_feature 8845..8943 /gene="trol" /note="EGF-like domain; Region: EGF; pfam00008" /db_xref="CDD:394967" misc_feature 9085..9546 /gene="trol" /note="Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans. Proteins that contain LamG domains serve a variety of...; Region: LamG; cd00110" /db_xref="CDD:238058" misc_feature 9706..9804 /gene="trol" /note="Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the...; Region: EGF_CA; cd00054" /db_xref="CDD:238011" misc_feature 9829..10290 /gene="trol" /note="Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans. Proteins that contain LamG domains serve a variety of...; Region: LamG; cd00110" /db_xref="CDD:238058" polyA_site 11089 /gene="trol" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ggtacagttg tgcccaagct acgatacaca tgccccaagg gcaaattcac ctgccgggac 61 ttgagctgca tatcgattgt ccatcgctgc gatggtcggg ccgattgtcc aaacgaccga 121 tcggatgagg agggctgtcc ctgtctgtac gacaagtggc agtgtgacga tggcacctgc 181 atagccaagg agctgctctg caatggcaat atcgattgtc ccgaggacat ttccgatgaa 241 cgctactgcg aggccaccac acgactaaag cccagcgact gcggtccgga tcagttcttc 301 tgcgatgatt tatgctataa tcgctctatt cgatgcaatg gccatatgga ttgctcagat 361 ggcagtgatg agatcgcttg tagctcgctg tcagtgcttc catgtccaca gcaccagtgt 421 cccagtggca ggtgttattc ggaaagtgag cgatgcgatc gccacaggca ctgcgaggat 481 ggctccgatg aggccaactg ctgttacgcg gatcaattcc gctgcaataa tggtgactgc 541 attgcggaat cggctcattg cgatggaaat atcgattgta gcgaccagtc cgatgaactc 601 gactgcggag gagactcgca gtgtctgccc aaccaattcc gctgcaagaa tggccaatgt 661 gtgagctcta cagcgcgttg caacaagcgt tccgattgtt tggatggctc cgatgagcag 721 aattgtgcca atgaacctaa caactccgga cgtggaacga accaattgaa actcaagacc 781 tatcccgaca accaaatcat taaggagagt cgtgaggtca tcttccgttg ccgtgacgaa 841 ggtcccaacc gcgccaaggt caagtggtcg cgacccggcg gacgtcccct gccccccggt 901 ttcaccgatc gcaatggccg cctggagatc cccaacatca gggtggagga tgctggcgcc 961 tatgtctgcg aggccgtggg ctatgccaac tatattcccg gtcagcacgt caccgtaaac 1021 ctcaacgtcg agcgcttaaa cgaacgcgaa atccgtccgg actcagcctg tacggagtac 1081 caggccacct gcatgaacgg cgagtgtatc gataagtcgg gcatctgcga tggacatccg 1141 gactgttcgg atggctccga tgagcacagc tgcagtttgg gtttgaagtg tcagcccaac 1201 cagttcatgt gctccaattc caagtgtgtg gatcgcacct ggcgctgtga tggcgagaac 1261 gactgcggcg ataactccga tgagacctct tgcgatccgg aaccaagtga tgctccgtgc 1321 cgatacgacg aattccagtg ccgcagcggt cattgcattc ccaagagctt ccagtgcgac 1381 tatatgaacg attgtaccga tggtaccgat gaaattggat gctcggtgcc ctctccaatg 1441 accctacccg caccctcgat tgtcgtgatg gagtacgagg tcctcgagct gacctgcgtg 1501 ggcaccggcg tcccgacgcc gacgatcgtg tggcgtctca actggggcca tgtgcccgag 1561 aagtgtgaat cgaagagcta cggcggaacc ggaaccctgc gctgtccgaa catgaggccc 1621 caggacagtg gtgcctactc gtgcgagttc atcaacacac gcggcacctt ctatccgaaa 1681 acgaactcga ttgtcaccgt tacgccggtg cgctcggatg tctgcaaggc cggattcttc 1741 aatatgctgg cccgcaagtc ggaggaatgc gtccagtgct tctgctttgg cgtttcgacc 1801 aactgtgaca gtgccaattt gttcacctac gccattcagc caccgatcct ttcgcaccgc 1861 gtggtcagcg ttgaactcag tccgttccgt caaattgtca tcaatgaggc tagtccgggt 1921 caggatctgc tcaccttgca ccatggtgtt cagttcaggg catcgaacgt acactacaac 1981 ggccgggaga caccattctt ggccctgccc gctgagtata tgggcaacca gctgaagtcc 2041 tatggcggca atctgcgcta cgaggtcagg tacaatggca acggtagacc ggtcagcgga 2101 cccgatgtca tcatcaccgg caacagtttc acgctaaccc atcgcgttcg cactcatccg 2161 ggtcagaaca acagggtgac tattcccttc ctgccgggag gctggacgaa gccggatggt 2221 cgcaagggaa cgcgagagga catcatgatg atactggcca atgtggacaa tattctgatt 2281 cgactgggct acctggatag cacagctcgc gaagtggatc tgataaatat cgccttggat 2341 tcggccggaa gtgccgatca gggattgggc agtgcctcgc tcgtggagaa gtgcacctgt 2401 ccgcccggct atgttggtga ttcgtgcgag tcctgtgcct cgggctatgt tcgccaggcc 2461 cgcggacctt ggctgggtca ttgtgtgccc ttcaccccgg aaccgtgccc agcgggaacc 2521 tacggcaatc cccgacttgg tgttccctgc caggagtgtc cgtgccccca cgcgggcgcc 2581 aataactttg ccagcggctg ccaacagagt cccgatggcg atgtgatttg ccgctgcaac 2641 gaaggctatg ccggcaagag gtgcgagcac tgcgcccagg gttaccaggg taatccgttg 2701 gcaccgggag gagtctgtcg caagataccc gatagttcgt gcaatgtcga cggcacctac 2761 aacatctaca gcaatggaac gtgccagtgc aaggatagcg tgattggcga acagtgcgac 2821 acctgcgcgc cgaagagttt ccacctcaat tcgttcacct acaccggttg catcgagtgc 2881 ttctgcagtg gagtgggctt ggattgtgac agtagttcgt ggtatcgcaa ccaggtcacc 2941 agcacctttg gacgaacgcg cgtcaatcat ggattcgccc tgattagcga ctatatgcgc 3001 aataccccgg taacggtgcc cgtttccatg tccacccagg ccaatgcctt gagcttcgtg 3061 ggatccgccg agcaggccgg taatacgctc tactggagtc ttcccgccgc cttcctgggc 3121 aacaagctga cctcgtacgg aggcaagttg agctacacgc tcagctacag tcccctgccc 3181 agcggcatta tgtcgcgcaa cagtgccccc gatgtggtga tcaagagcgg cgaggatctg 3241 aggctcatcc attacaggaa gtcgcaggtc agtcccagtg tggccaacac ctatgccgtg 3301 gagatcaagg agagcgcatg gcagcgcggc gatgaactgg tgcctaaccg tgaacacgtc 3361 ctgatggccc tcagcaatat tacggccatc tatatcaagg ccacgtacac gactagcacc 3421 aaggaggcct cgctgcgatc ggtcacattg gatacggcca cggccaccaa tctgggcacc 3481 gcacgtgccg tcgaagtgga gcagtgccgc tgtcccgagg gctatttggg tctctcctgc 3541 gagcagtgtg ctcctggcta tacgcgcgat ccggaggcag gaatctatct gggtctctgc 3601 aggccctgcg agtgcaatgg acattccaag tattgcaaca gtgagacagg cgaatgcgaa 3661 agctgttccg acaacaccga aggattcaat tgtgaccgat gcgccgccgg ctatgtgggt 3721 gatgccaccc gaggaacttc gtacgactgt caatacgatg acggcggcta tccgacgtcg 3781 cgtccaccgg caccgggcaa tcagacggcc gaatgcctgg tgaattgcca acaggaggga 3841 accgccggtt gccgcggcta ccagtgcgag tgcaagagga atgtggctgg cgatcgatgc 3901 gatcagtgcc gccccggaac ctatggactg tcggcccaaa atccggacgg ttgcaaggag 3961 tgctactgct ccggactgac caaccagtgc cgctcggcgt ctctctaccg ccagctgata 4021 cccgtggact tcatttcgac gccaccattg ataacagacg aattcggcga catcatggat 4081 agggataacc ttgtgcccga cgtgcccagg aatgtgtata cctacaagca cacctcctac 4141 acgcccaagt actggagcct gaggggtagt gtgctgggca accagctgtt gtcgtacggc 4201 ggccgcttgg agtacagcct gattgtggag tccgttggcc gggaccatcg tggcaaggat 4261 gtggtcctaa ttggcaacgg actcaagctg atctggtcgc gacccgatgg ccatgacaac 4321 gagcaggaat accatgtgcg tttgcatgag gacgagcagt ggacggttga ggatcgtgga 4381 tcggcacgac aggccacgcg ggccgacttc atgactgtgc tgtcggatct gcagcacatc 4441 ctgatcctgg ccacacccaa ggtgcccacg gtcagcacct cgattagcaa tgtcatcctg 4501 gagagttcga taaccacgag agcgcctgga gctacgcatg cctccgatat cgagttgtgc 4561 cagtgtccat ccggttatac gggcacttcc tgtgagtcct gcgcaccact gcactaccgc 4621 gacgcctctg gacgctgcag tcagtgtcct tgcgacgctt ccaacacgga atcctgcggc 4681 ttggtcagcg gcggtaacgt cgaatgccag tgcaggccac gctggagggg tgatcgctgc 4741 cgggaaattg acacatcgcc cattatcgaa gaaccgcccc agatatgtga tttaagcagg 4801 ggattctgtt gcagcggctt tcagttcgat atcgcaccga acgagacaat ctcgtttaat 4861 gacaccctgc agatatataa gggcaacaga atcataggaa atatgaccaa gctgcgctac 4921 ggctgtccat cgcgagaaac taacgaaccg actccggaac cggataccag taccgatgat 4981 cccgtgcgca cccagatcat agtgtcgatt gccaggccag agattaccat tctgcccgtg 5041 ggtggatcgc tgaccctcag ctgtaccggt cgaatgcgct ggaccaatag cccagtgttt 5101 gtgaactggt acaagcaggg cagtcacctg cccgagggag tcgaggtgca aggcggtaat 5161 ctgcagctgt tcaacctgca gatcagcgat tctggaatct acatctgcca ggccgtaagc 5221 aacgagaccg gccacagctt tacggaccac gtctccatca ccgtttccca ggaggaccaa 5281 cgctcgccgg ctcacattgt ggatttgccc aacgacgtga ccttcgagga gtacgtaagc 5341 aatgagatcg tctgcgaggt ggagggcaac ccaccaccca ctgtcacctg gactcgcgtg 5401 gatggccatg cggacgccca aagtacgcga acggacaaca atcggctggt cttcgattcg 5461 ccgaggaaat cggacgaggg tcgctatcgc tgccaggcag agaatagcct gagtcgggag 5521 gagaagtacg tagtcgtgta tgtccggagc aatcctcccc agccgccgcc gcagcaggat 5581 cgtttgtaca tcacaccgca ggaggtgaac ggtgtggccg gtgactcctt ccagttgtcc 5641 tgccaattca ccagcgctgc ctctctgcgc tacgattggt cccacgatgg tcgctccctg 5701 tccgcgtcgt caccccgaaa tgttgtggtc cgcggaaatg tcctggaagt ccgcgatgcc 5761 aacgttcgcg actccggcac ctacacctgt gtggccttcg acctgcgcac ccgacgcaac 5821 ttcaccgaga gcgcacgggt ctacatcgag cagcccaacg agccgggaat ccttggcgac 5881 aagccgcata tcttgacctt ggagcagaac atcataattg tgcaaggcga ggacttgagc 5941 atcacatgtg aggcaagtgg aacgccctat ccctcgatta agtggaccaa ggtgcaggag 6001 aatctggccg aaaatgtccg catcagtggc aatgtgctca ccatctacgg aggccgcagt 6061 gagaatcgtg gtctttactc ctgcatcgcc gagaactctc acggcagcga tcagtccagc 6121 acaagcatcg atattgaacc ccgggagcgg ccgagtctta cgattgatac ggccacccaa 6181 aaggtttcgg ttggctccca ggcgtccctt tactgtgccg cccagggcat tcccgaaccg 6241 accgtcgagt gggttcgaac ggatggtcag ccactgtcgc cgcgtcacaa ggtccaggca 6301 cccggctatg ttgtgatcga tgacattgtg ctcgatgata gcggtaccta cgagtgccgg 6361 gcgagcaaca tagctggcca ggtgagcggc ttggccacca ttaacgtcca ggagccaact 6421 cttgtgcgga tcgaaccaga taggcaacac catatcgtca cccagggcga cgaactctcg 6481 ctcagctgcg tgggcagtgg cgtccctact ccttcggtct tttggagttt cgagggaaga 6541 gacgttgaca ggatgggagt accggaaggt gctgtttttg cgcaaccttt ccgaaccaac 6601 actgccgacg tgaaaatctt ccgggtgagc aaggagaacg aaggcatcta cgtctgtcac 6661 ggatccaatg acgcgggtga agatcaacaa tacattcgcg tggaggtaca acccagacgg 6721 ggtgacgtcg gtgcaggagg agatgacaat ggtgatgtcg atacccgaca gccccccaat 6781 cggccccaaa tccaaccgaa tccattgagc aacgaacgcc tgaccaccga attgggcaac 6841 aatgtgaccc tcatctgcaa cgtggacaac gtgaacacgg aatgggaacg cgtcgatggc 6901 acacccctgc cgcacaatgc ctacacggtg agaaatacgc tggtgattgt cttcgtggag 6961 ccgcagaatc tgggtcagta ccgctgcaat ggaatcggtc gcgatggacg tgtggaggcc 7021 catgtggtga gggagctggt tctcctgccc ctgcccagga tcaccttcta tcccaacatc 7081 ccgctgaccg tggagctggg ccagaacttg gatgtctact gccaggtgga gaacgtgcgt 7141 ccggaggacg tgcattggac caccgacaac aatcgaccac tgcccagttc cgtacgcatc 7201 gagggcaatg tcctcaggtt cgcgtccatc actcaggctg ctgccggtga ataccgctgc 7261 tcggccacca atcaatatgg aagccgatcg aagaacgcca gggtggtggt gaaacagccc 7321 agtggcttcc agcccgttcc ccactcgcag gtgcaacagc gtcaggtggg cgactccatc 7381 cagttgcgat gccgcctgac cacccagtac ggcgacgagg ttcgcggcaa tatccagttc 7441 aactggtacc gtgaggacgg cagccccttg ccccgcggtg tccgtccgga tagccaggtg 7501 ctgcagctgg ttaaattgca gcccgaggac gagggccgct acatctgcaa ctcgtacgat 7561 ttgggcagcg ggcagcaact gccccccgtc tccatcgact tgcaagtact aagaactact 7621 acccagtatc ctttcaatcg gtttaagggc ggtgtctccc tgaaagacac gccctgcatg 7681 gttctgtata tttgtgcagc ggtaccagcg gctccccaga accccatcta cctgccgcca 7741 gtggcgccac cacgttcgcc cgaaaggatc ctcgagcccc aactgagcct gagtgtacaa 7801 tcctcgaacc tgccagccgg cgacggcacc accgtcgagt gcttctcctc cgatgactcc 7861 tacccagatg tcgtgtggga acgcgccgat ggagctccac tcagcgaaaa tgtccagcaa 7921 gtgggcaata acctggtgat tagtaacgtg gcctccaccg atgccggtaa ctatgtgtgc 7981 aagtgcaaga cggacgaggg agatctgtat accaccagct acaaactgga ggtcgaggag 8041 cagccccatg aactgaagag ctccaagata gtctacgcca aggttggcgg aaatgccgac 8101 ttgcagtgcg gagccgatga agatcgacag cccagctacc gttggtctcg ccaatacgga 8161 caacttcagg cgggacgcag tctgcagaat gagaaacttt cgttggatcg cgttcaggcc 8221 aacgatgccg gaacttatgt ttgttcggcc caatacagcg atggcgagac ggttgacttc 8281 cccaacattc tggttgtgac cggggcgatt ccccagttcc gccaggagcc ccgcagctac 8341 atgagcttcc ccacgctctc gaactcctcg ttcaagttca acttcgagct gaccttccgg 8401 ccggaaaacg ccgacggact gctgctcttc aatggacaga cccgcggaag cggtgactat 8461 atcgcactct cgctgaagga tcgctatgcg gagttccggt tcgattttgg cggtaaaccg 8521 ttgctggtgc gagcggagga gccactggct ttggatgaat ggcacacggt gcgcgtgagt 8581 cgcttcaagc gggatggcta catccaggtg gacgaccagc atccggtggc cttccccacc 8641 tcccagcatc agcagatacc ccagttggaa ctgattgagg atctgtacat tggcggcgtg 8701 cccaactggg agttcctgcc cgccgaggcg gtgggtcagc aatcaggctt cgtgggctgc 8761 attagccggc tgaccctgca gggacgcacc gtggagctga tccgggaggc caagttcaag 8821 gagggcatca ccgattgccg gccctgcgcc cagggaccct gccagaacaa gggcgtctgc 8881 ctggagagcc agacggagca ggcctacacc tgcgtctgcc agccgggctg gactggccgg 8941 gattgtgcca tcgagggcac ccagtgcacc gcaggagttt gcggctcggg acgctgcgag 9001 aatacggaga acgacatgga gtgcctgtgc ccgctgaaca gggcaggcga tcgatgccag 9061 tacaatgaga ttctaaatga acagagcttg aatttcaaga gcaacagctt tgcggcctac 9121 ggaactccca aggtcaccaa agtaaacatc acactctccg ttcgtcccgc gagcctggag 9181 gactctgtga tcctgtacac ggcggaatcc actctgccca gcggcgatta cctggctttg 9241 gtccttcgcg gtggccacgc ggagctgctg atcaacacgg ccgcccgctt ggatcccgtg 9301 gtggtgcgtt cggcggaacc gctgcccctc aatcgctgga ccagaatcga gatcaggcgt 9361 cgcctgggcg agggaatcct caaggtgggc gatggacccg agcgaaaggc caaggcaccg 9421 ggatccgatc gcattctgtc gctcaagacc cacctctttg tgggcggcgt cgatcggtcg 9481 accgtaaaga tcaaccgtga tgtgaacatc accaagggct tcgatggctg catctcgaag 9541 ctgtacaact cgcagaaatc cgtcaatctg ctgggtgaca tcagggatgc ggcgaatgtc 9601 cagaactgtg gggaggcgaa tgagatagat gacgatgagt atgagatgcc agtagcgctg 9661 ccatcgccta aggtcgccga gaatgaacgt cagctgatgg cgccgtgtgc cagtgatccc 9721 tgcgagaacg ggggaagctg cagcgagcag gaggacatgg ccatctgctc ctgtcccttc 9781 ggcttcagcg gcaaacactg ccagaatcac ctccagctga gcttcaatgc ctcgttccgc 9841 ggcgatggct acgtggagct gaaccgcagc cacttccaac ccgccctgga gcagacgtac 9901 tcccacattg gcattgtgtt caccaccaac aagccgaatg gcctgctttt ctggtggggc 9961 caggaggccg gggaggagta caccggacag gacttcattg ccgccgccgt ggtcgatggc 10021 tatgtggagt actcgatgag gctcgatggc gaggaggcgg tcattcggaa cagcgatatc 10081 cgcgtggaca atggcgagcg gcacattgtg atcgccaagc gggatgagaa caccgccatg 10141 ctggaactcg atcagatcct ggacacgggc gatacgcgac ccaccatcaa caaggcaatg 10201 aagctgccgg gcaatgtgtt tgtcggtggc gctcctgatg tcgcggcatt cacgggcttc 10261 cgctacaagg acaatttcaa cggctgcatt gtggtcgtcg agggcgaaac cgtgggccaa 10321 attaacctta gttcagctgc catcaatgga gtgaatgcca acgtgtgtcc cgctaacgac 10381 gaacctctgg gaggaaccga accgccagtc gtctgaggac acaaccagca accgaaatta 10441 gctttttaat taaacattaa caaatgaaac aaaaagaaaa acaattttta tatatacaac 10501 atatgaataa gccccaagca aacctacaaa aaattgaata ttatacgacg aacagataat 10561 ataaaaacaa aaaaagagag aaacgatcac ttctactaca attgcttctt cgatccttaa 10621 gtctaggtta aagattgtag caagaaaaca agcgaatatc acaaacattt atttaacaag 10681 aacgccatgc gagaagtgaa acgaaacaga aacaataatg caattaatgc agataataca 10741 gataaagcct agaaccctaa gaactaacta actaactcga acaagaacaa caacgcatac 10801 tagccaactg caaccacaac aaccacaata gtgaaggcat tttaattata attttagtct 10861 ctagcttata actatgacta cgactcgttt tttttgtgag cccagtgtaa aatgttggaa 10921 atcggaaatt ggccctacac acaaacacac acaagttatt aattaaatac caattgatac 10981 catataatga taaatgaaat actatgaatg caactattgt gaacgaacga aaaccgttga 11041 gtggataaaa agcataagca gaagatatat taaaatgaaa tcaacaaca