Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii terribly reduced optic lobes


LOCUS       XM_070218443           10849 bp    mRNA    linear   INV 09-DEC-2024
            (trol), transcript variant X31, mRNA.
ACCESSION   XM_070218443
VERSION     XM_070218443.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..10849
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..10849
                     /gene="trol"
                     /note="terribly reduced optic lobes; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 7
                     Proteins"
                     /db_xref="GeneID:108055788"
     CDS             106..10176
                     /gene="trol"
                     /codon_start=1
                     /product="basement membrane-specific heparan sulfate
                     proteoglycan core protein isoform X31"
                     /protein_id="XP_070074544.1"
                     /db_xref="GeneID:108055788"
                     /translation="MDCSDGSDEIACSSLSVLPCPQHQCPSGRCYSESERCDRHRHCE
                     DGSDEANCCYADQFRCNNGDCIAESAHCDGNIDCSDQSDELDCGGDSQCLPNQFRCKN
                     GQCVSSTARCNKRSDCLDGSDEQNCANEPNNSGRGTNQLKLKTYPDNQIIKESREVIF
                     RCRDEGPNRAKVKWSRPGGRPLPPGFTDRNGRLEIPNIRVEDAGAYVCEAVGYANYIP
                     GQHVTVNLNVERLNEREIRPDSACTEYQATCMNGECIDKSGICDGHPDCSDGSDEHSC
                     SLGLKCQPNQFMCSNSKCVDRTWRCDGENDCGDNSDETSCDPEPSDAPCRYDEFQCRS
                     GHCIPKSFQCDYMNDCTDGTDEIGCSVPSPMTLPAPSIVVMEYEVLELTCVGTGVPTP
                     TIVWRLNWGHVPEKCESKSYGGTGTLRCPNMRPQDSGAYSCEFINTRGTFYPKTNSIV
                     TVTPVRSDVCKAGFFNMLARKSEECVQCFCFGVSTNCDSANLFTYAIQPPILSHRVVS
                     VELSPFRQIVINEASPGQDLLTLHHGVQFRASNVHYNGRETPFLALPAEYMGNQLKSY
                     GGNLRYEVRYNGNGRPVSGPDVIITGNSFTLTHRVRTHPGQNNRVTIPFLPGGWTKPD
                     GRKGTREDIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGSADQGLGSASLVEK
                     CTCPPGYVGDSCESCASGYVRQARGPWLGHCVPFTPEPCPAGTYGNPRLGVPCQECPC
                     PHAGANNFASGCQQSPDGDVICRCNEGYAGKRCEHCAQGYQGNPLAPGGVCRKIPDSS
                     CNVDGTYNIYSNGTCQCKDSVIGEQCDTCAPKSFHLNSFTYTGCIECFCSGVGLDCDS
                     SSWYRNQVTSTFGRTRVNHGFALISDYMRNTPVTVPVSMSTQANALSFVGSAEQAGNT
                     LYWSLPAAFLGNKLTSYGGKLSYTLSYSPLPSGIMSRNSAPDVVIKSGEDLRLIHYRK
                     SQVSPSVANTYAVEIKESAWQRGDELVPNREHVLMALSNITAIYIKATYTTSTKEASL
                     RSVTLDTATATNLGTARAVEVEQCRCPEGYLGLSCEQCAPGYTRDPEAGIYLGLCRPC
                     ECNGHSKYCNSETGECESCSDNTEGFNCDRCAAGYVGDATRGTSYDCQYDDGGYPTSR
                     PPAPGNQTAECLVNCQQEGTAGCRGYQCECKRNVAGDRCDQCRPGTYGLSAQNPDGCK
                     ECYCSGLTNQCRSASLYRQLIPVDFISTPPLITDEFGDIMDRDNLVPDVPRNVYTYKH
                     TSYTPKYWSLRGSVLGNQLLSYGGRLEYSLIVESVGRDHRGKDVVLIGNGLKLIWSRP
                     DGHDNEQEYHVRLHEDEQWTVEDRGSARQATRADFMTVLSDLQHILILATPKVPTVST
                     SISNVILESSITTRAPGATHASDIELCQCPSGYTGTSCESCAPLHYRDASGRCSQCPC
                     DASNTESCGLVSGGNVECQCRPRWRGDRCREIDTSPIIEEPPQICDLSRGFCCSGFQF
                     DIAPNETISFNDTLQIYKGNRIIGNMTKLRYGCPSRETNEPTPEPDTSTDDPVRTQII
                     VSIARPEITILPVGGSLTLSCTGRMRWTNSPVFVNWYKQGSHLPEGVEVQGGNLQLFN
                     LQISDSGIYICQAVSNETGHSFTDHVSITVSQEDQRSPAHIVDLPNDVTFEEYVSNEI
                     VCEVEGNPPPTVTWTRVDGHADAQSTRTDNNRLVFDSPRKSDEGRYRCQAENSLSREE
                     KYVVVYVRSNPPQPPPQQDRLYITPQEVNGVAGDSFQLSCQFTSAASLRYDWSHDGRS
                     LSASSPRNVVVRGNVLEVRDANVRDSGTYTCVAFDLRTRRNFTESARVYIEQPNEPGI
                     LGDKPHILTLEQNIIIVQGEDLSITCEASGTPYPSIKWTKVQENLAENVRISGNVLTI
                     YGGRSENRGLYSCIAENSHGSDQSSTSIDIEPRERPSLTIDTATQKVSVGSQASLYCA
                     AQGIPEPTVEWVRTDGQPLSPRHKVQAPGYVVIDDIVLDDSGTYECRASNIAGQVSGL
                     ATINVQEPTLVRIEPDRQHHIVTQGDELSLSCVGSGVPTPSVFWSFEGRDVDRMGVPE
                     GAVFAQPFRTNTADVKIFRVSKENEGIYVCHGSNDAGEDQQYIRVEVQPRRGDVGAGG
                     DDNGDVDTRQPPNRPQIQPNPLSNERLTTELGNNVTLICNVDNVNTEWERVDGTPLPH
                     NAYTVRNTLVIVFVEPQNLGQYRCNGIGRDGRVEAHVVRELVLLPLPRITFYPNIPLT
                     VELGQNLDVYCQVENVRPEDVHWTTDNNRPLPSSVRIEGNVLRFASITQAAAGEYRCS
                     ATNQYGSRSKNARVVVKQPSGFQPVPHSQVQQRQVGDSIQLRCRLTTQYGDEVRGNIQ
                     FNWYREDGSPLPRGVRPDSQVLQLVKLQPEDEGRYICNSYDLGSGQQLPPVSIDLQVL
                     RTTTQYPFNRFKGGVSLKDTPCMVLYICAAVPAAPQNPIYLPPVAPPRSPERILEPQL
                     SLSVQSSNLPAGDGTTVECFSSDDSYPDVVWERADGAPLSENVQQVGNNLVISNVAST
                     DAGNYVCKCKTDEGDLYTTSYKLEVEEQPHELKSSKIVYAKVGGNADLQCGADEDRQP
                     SYRWSRQYGQLQAGRSLQNEKLSLDRVQANDAGTYVCSAQYSDGETVDFPNILVVTGA
                     IPQFRQEPRSYMSFPTLSNSSFKFNFELTFRPENADGLLLFNGQTRGSGDYIALSLKD
                     RYAEFRFDFGGKPLLVRAEEPLALDEWHTVRVSRFKRDGYIQVDDQHPVAFPTSQHQQ
                     IPQLELIEDLYIGGVPNWEFLPAEAVGQQSGFVGCISRLTLQGRTVELIREAKFKEGI
                     TDCRPCAQGPCQNKGVCLESQTEQAYTCVCQPGWTGRDCAIEGTQCTAGVCGSGRCEN
                     TENDMECLCPLNRAGDRCQYNEILNEQSLNFKSNSFAAYGTPKVTKVNITLSVRPASL
                     EDSVILYTAESTLPSGDYLALVLRGGHAELLINTAARLDPVVVRSAEPLPLNRWTRIE
                     IRRRLGEGILKVGDGPERKAKAPGSDRILSLKTHLFVGGVDRSTVKINRDVNITKGFD
                     GCISKLYNSQKSVNLLGDIRDAANVQNCGEANEIDDDEYEMPVALPSPKVAENERQLM
                     APCASDPCENGGSCSEQEDMAICSCPFGFSGKHCQNHLQLSFNASFRGDGYVELNRSH
                     FQPALEQTYSHIGIVFTTNKPNGLLFWWGQEAGEEYTGQDFIAAAVVDGYVEYSMRLD
                     GEEAVIRNSDIRVDNGERHIVIAKRDENTAMLELDQILDTGDTRPTINKAMKLPGNVF
                     VGGAPDVAAFTGFRYKDNFNGCIVVVEGETVGQINLSSAAINGVNANVCPANDEPLGG
                     TEPPVV"
     misc_feature    169..261
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(172..174,196..198,229..234)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(208..210,217..219,229..231,247..252)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    238..252
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    262..366
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(277..279,301..303,334..339)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(313..315,322..324,334..336,352..357)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    343..357
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    382..486
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(397..399,421..423,454..459)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(433..435,442..444,454..456,472..477)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    463..477
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    529..735
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    829..933
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(844..846,868..870,901..906)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(880..882,889..891,901..903,919..924)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    910..924
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    949..1053
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(964..966,988..990,1021..1026)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1000..1002,1009..1011,1021..1023,1039..1044)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1030..1044
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1078..1182
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1093..1095,1117..1119,1150..1155)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1129..1131,1138..1140,1150..1152,1168..1173)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1159..1173
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1234..1461
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    1243..1257
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    1282..1296
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    1351..1365
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    1393..1410
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    1435..1446
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    1756..2148
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    2317..2478
                     /gene="trol"
                     /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053"
                     /db_xref="CDD:395007"
     misc_feature    order(2317..2319,2323..2325,2359..2361,2389..2391,
                     2395..2397,2422..2424)
                     /gene="trol"
                     /note="EGF-like motif [active]"
                     /db_xref="CDD:238012"
     misc_feature    2497..2610
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domai;
                     Region: EGF_Lam; smart00180"
                     /db_xref="CDD:214543"
     misc_feature    2851..3261
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    <3262..3342
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domain;
                     laminins are the major noncollagenous components of
                     basement membranes that mediate cell adhesion, growth
                     migration, and differentiation; the laminin-type epidermal
                     growth factor-like module occurs in...; Region: EGF_Lam;
                     cd00055"
                     /db_xref="CDD:238012"
     misc_feature    3364..3513
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domain;
                     laminins are the major noncollagenous components of
                     basement membranes that mediate cell adhesion, growth
                     migration, and differentiation; the laminin-type epidermal
                     growth factor-like module occurs in...; Region: EGF_Lam;
                     cd00055"
                     /db_xref="CDD:238012"
     misc_feature    order(3367..3369,3373..3375,3394..3396,3415..3417,
                     3424..3426,3451..3453)
                     /gene="trol"
                     /note="EGF-like motif [active]"
                     /db_xref="CDD:238012"
     misc_feature    <3622..3714
                     /gene="trol"
                     /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053"
                     /db_xref="CDD:395007"
     misc_feature    3910..4314
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    4777..5025
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    4810..4824
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    4858..4872
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    4915..4929
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    4957..4974
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    5002..5013
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    <5104..5265
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    5356..5607
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    5389..5403
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    5428..5442
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    5497..5511
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    5539..5556
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    5644..5886
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    5695..5709
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409570"
     misc_feature    5734..5748
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409570"
     misc_feature    5791..5805
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409570"
     misc_feature    5833..5850
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409570"
     misc_feature    5872..5883
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409570"
     misc_feature    5938..6168
                     /gene="trol"
                     /note="Immunoglobulin I-set domain; Region: I-set;
                     pfam07679"
                     /db_xref="CDD:400151"
     misc_feature    5962..5976
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    6001..6015
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    6106..6123
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    6145..6156
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    6205..6468
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    6235..6249
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    6274..6288
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    6406..6423
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    6841..7071
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    6868..6882
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    6907..6921
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    6967..6981
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    7009..7026
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    7105..>7308
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    7138..7152
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    7186..7209
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    7255..7269
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    7555..7761
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    7627..7641
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    7690..7701
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    7729..7746
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    7831..8031
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    7855..7869
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    7894..7908
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    7951..7965
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    7993..8010
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    8095..8538
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     misc_feature    8605..8703
                     /gene="trol"
                     /note="EGF-like domain; Region: EGF; pfam00008"
                     /db_xref="CDD:394967"
     misc_feature    8845..9306
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     misc_feature    9466..9564
                     /gene="trol"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    9589..10050
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     polyA_site      10849
                     /gene="trol"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 caatcggaag cagccaccac acgactaaag cccagcgact gcggtccgga tcagttcttc
       61 tgcgatgatt tatgctataa tcgctctatt cgatgcaatg gccatatgga ttgctcagat
      121 ggcagtgatg agatcgcttg tagctcgctg tcagtgcttc catgtccaca gcaccagtgt
      181 cccagtggca ggtgttattc ggaaagtgag cgatgcgatc gccacaggca ctgcgaggat
      241 ggctccgatg aggccaactg ctgttacgcg gatcaattcc gctgcaataa tggtgactgc
      301 attgcggaat cggctcattg cgatggaaat atcgattgta gcgaccagtc cgatgaactc
      361 gactgcggag gagactcgca gtgtctgccc aaccaattcc gctgcaagaa tggccaatgt
      421 gtgagctcta cagcgcgttg caacaagcgt tccgattgtt tggatggctc cgatgagcag
      481 aattgtgcca atgaacctaa caactccgga cgtggaacga accaattgaa actcaagacc
      541 tatcccgaca accaaatcat taaggagagt cgtgaggtca tcttccgttg ccgtgacgaa
      601 ggtcccaacc gcgccaaggt caagtggtcg cgacccggcg gacgtcccct gccccccggt
      661 ttcaccgatc gcaatggccg cctggagatc cccaacatca gggtggagga tgctggcgcc
      721 tatgtctgcg aggccgtggg ctatgccaac tatattcccg gtcagcacgt caccgtaaac
      781 ctcaacgtcg agcgcttaaa cgaacgcgaa atccgtccgg actcagcctg tacggagtac
      841 caggccacct gcatgaacgg cgagtgtatc gataagtcgg gcatctgcga tggacatccg
      901 gactgttcgg atggctccga tgagcacagc tgcagtttgg gtttgaagtg tcagcccaac
      961 cagttcatgt gctccaattc caagtgtgtg gatcgcacct ggcgctgtga tggcgagaac
     1021 gactgcggcg ataactccga tgagacctct tgcgatccgg aaccaagtga tgctccgtgc
     1081 cgatacgacg aattccagtg ccgcagcggt cattgcattc ccaagagctt ccagtgcgac
     1141 tatatgaacg attgtaccga tggtaccgat gaaattggat gctcggtgcc ctctccaatg
     1201 accctacccg caccctcgat tgtcgtgatg gagtacgagg tcctcgagct gacctgcgtg
     1261 ggcaccggcg tcccgacgcc gacgatcgtg tggcgtctca actggggcca tgtgcccgag
     1321 aagtgtgaat cgaagagcta cggcggaacc ggaaccctgc gctgtccgaa catgaggccc
     1381 caggacagtg gtgcctactc gtgcgagttc atcaacacac gcggcacctt ctatccgaaa
     1441 acgaactcga ttgtcaccgt tacgccggtg cgctcggatg tctgcaaggc cggattcttc
     1501 aatatgctgg cccgcaagtc ggaggaatgc gtccagtgct tctgctttgg cgtttcgacc
     1561 aactgtgaca gtgccaattt gttcacctac gccattcagc caccgatcct ttcgcaccgc
     1621 gtggtcagcg ttgaactcag tccgttccgt caaattgtca tcaatgaggc tagtccgggt
     1681 caggatctgc tcaccttgca ccatggtgtt cagttcaggg catcgaacgt acactacaac
     1741 ggccgggaga caccattctt ggccctgccc gctgagtata tgggcaacca gctgaagtcc
     1801 tatggcggca atctgcgcta cgaggtcagg tacaatggca acggtagacc ggtcagcgga
     1861 cccgatgtca tcatcaccgg caacagtttc acgctaaccc atcgcgttcg cactcatccg
     1921 ggtcagaaca acagggtgac tattcccttc ctgccgggag gctggacgaa gccggatggt
     1981 cgcaagggaa cgcgagagga catcatgatg atactggcca atgtggacaa tattctgatt
     2041 cgactgggct acctggatag cacagctcgc gaagtggatc tgataaatat cgccttggat
     2101 tcggccggaa gtgccgatca gggattgggc agtgcctcgc tcgtggagaa gtgcacctgt
     2161 ccgcccggct atgttggtga ttcgtgcgag tcctgtgcct cgggctatgt tcgccaggcc
     2221 cgcggacctt ggctgggtca ttgtgtgccc ttcaccccgg aaccgtgccc agcgggaacc
     2281 tacggcaatc cccgacttgg tgttccctgc caggagtgtc cgtgccccca cgcgggcgcc
     2341 aataactttg ccagcggctg ccaacagagt cccgatggcg atgtgatttg ccgctgcaac
     2401 gaaggctatg ccggcaagag gtgcgagcac tgcgcccagg gttaccaggg taatccgttg
     2461 gcaccgggag gagtctgtcg caagataccc gatagttcgt gcaatgtcga cggcacctac
     2521 aacatctaca gcaatggaac gtgccagtgc aaggatagcg tgattggcga acagtgcgac
     2581 acctgcgcgc cgaagagttt ccacctcaat tcgttcacct acaccggttg catcgagtgc
     2641 ttctgcagtg gagtgggctt ggattgtgac agtagttcgt ggtatcgcaa ccaggtcacc
     2701 agcacctttg gacgaacgcg cgtcaatcat ggattcgccc tgattagcga ctatatgcgc
     2761 aataccccgg taacggtgcc cgtttccatg tccacccagg ccaatgcctt gagcttcgtg
     2821 ggatccgccg agcaggccgg taatacgctc tactggagtc ttcccgccgc cttcctgggc
     2881 aacaagctga cctcgtacgg aggcaagttg agctacacgc tcagctacag tcccctgccc
     2941 agcggcatta tgtcgcgcaa cagtgccccc gatgtggtga tcaagagcgg cgaggatctg
     3001 aggctcatcc attacaggaa gtcgcaggtc agtcccagtg tggccaacac ctatgccgtg
     3061 gagatcaagg agagcgcatg gcagcgcggc gatgaactgg tgcctaaccg tgaacacgtc
     3121 ctgatggccc tcagcaatat tacggccatc tatatcaagg ccacgtacac gactagcacc
     3181 aaggaggcct cgctgcgatc ggtcacattg gatacggcca cggccaccaa tctgggcacc
     3241 gcacgtgccg tcgaagtgga gcagtgccgc tgtcccgagg gctatttggg tctctcctgc
     3301 gagcagtgtg ctcctggcta tacgcgcgat ccggaggcag gaatctatct gggtctctgc
     3361 aggccctgcg agtgcaatgg acattccaag tattgcaaca gtgagacagg cgaatgcgaa
     3421 agctgttccg acaacaccga aggattcaat tgtgaccgat gcgccgccgg ctatgtgggt
     3481 gatgccaccc gaggaacttc gtacgactgt caatacgatg acggcggcta tccgacgtcg
     3541 cgtccaccgg caccgggcaa tcagacggcc gaatgcctgg tgaattgcca acaggaggga
     3601 accgccggtt gccgcggcta ccagtgcgag tgcaagagga atgtggctgg cgatcgatgc
     3661 gatcagtgcc gccccggaac ctatggactg tcggcccaaa atccggacgg ttgcaaggag
     3721 tgctactgct ccggactgac caaccagtgc cgctcggcgt ctctctaccg ccagctgata
     3781 cccgtggact tcatttcgac gccaccattg ataacagacg aattcggcga catcatggat
     3841 agggataacc ttgtgcccga cgtgcccagg aatgtgtata cctacaagca cacctcctac
     3901 acgcccaagt actggagcct gaggggtagt gtgctgggca accagctgtt gtcgtacggc
     3961 ggccgcttgg agtacagcct gattgtggag tccgttggcc gggaccatcg tggcaaggat
     4021 gtggtcctaa ttggcaacgg actcaagctg atctggtcgc gacccgatgg ccatgacaac
     4081 gagcaggaat accatgtgcg tttgcatgag gacgagcagt ggacggttga ggatcgtgga
     4141 tcggcacgac aggccacgcg ggccgacttc atgactgtgc tgtcggatct gcagcacatc
     4201 ctgatcctgg ccacacccaa ggtgcccacg gtcagcacct cgattagcaa tgtcatcctg
     4261 gagagttcga taaccacgag agcgcctgga gctacgcatg cctccgatat cgagttgtgc
     4321 cagtgtccat ccggttatac gggcacttcc tgtgagtcct gcgcaccact gcactaccgc
     4381 gacgcctctg gacgctgcag tcagtgtcct tgcgacgctt ccaacacgga atcctgcggc
     4441 ttggtcagcg gcggtaacgt cgaatgccag tgcaggccac gctggagggg tgatcgctgc
     4501 cgggaaattg acacatcgcc cattatcgaa gaaccgcccc agatatgtga tttaagcagg
     4561 ggattctgtt gcagcggctt tcagttcgat atcgcaccga acgagacaat ctcgtttaat
     4621 gacaccctgc agatatataa gggcaacaga atcataggaa atatgaccaa gctgcgctac
     4681 ggctgtccat cgcgagaaac taacgaaccg actccggaac cggataccag taccgatgat
     4741 cccgtgcgca cccagatcat agtgtcgatt gccaggccag agattaccat tctgcccgtg
     4801 ggtggatcgc tgaccctcag ctgtaccggt cgaatgcgct ggaccaatag cccagtgttt
     4861 gtgaactggt acaagcaggg cagtcacctg cccgagggag tcgaggtgca aggcggtaat
     4921 ctgcagctgt tcaacctgca gatcagcgat tctggaatct acatctgcca ggccgtaagc
     4981 aacgagaccg gccacagctt tacggaccac gtctccatca ccgtttccca ggaggaccaa
     5041 cgctcgccgg ctcacattgt ggatttgccc aacgacgtga ccttcgagga gtacgtaagc
     5101 aatgagatcg tctgcgaggt ggagggcaac ccaccaccca ctgtcacctg gactcgcgtg
     5161 gatggccatg cggacgccca aagtacgcga acggacaaca atcggctggt cttcgattcg
     5221 ccgaggaaat cggacgaggg tcgctatcgc tgccaggcag agaatagcct gagtcgggag
     5281 gagaagtacg tagtcgtgta tgtccggagc aatcctcccc agccgccgcc gcagcaggat
     5341 cgtttgtaca tcacaccgca ggaggtgaac ggtgtggccg gtgactcctt ccagttgtcc
     5401 tgccaattca ccagcgctgc ctctctgcgc tacgattggt cccacgatgg tcgctccctg
     5461 tccgcgtcgt caccccgaaa tgttgtggtc cgcggaaatg tcctggaagt ccgcgatgcc
     5521 aacgttcgcg actccggcac ctacacctgt gtggccttcg acctgcgcac ccgacgcaac
     5581 ttcaccgaga gcgcacgggt ctacatcgag cagcccaacg agccgggaat ccttggcgac
     5641 aagccgcata tcttgacctt ggagcagaac atcataattg tgcaaggcga ggacttgagc
     5701 atcacatgtg aggcaagtgg aacgccctat ccctcgatta agtggaccaa ggtgcaggag
     5761 aatctggccg aaaatgtccg catcagtggc aatgtgctca ccatctacgg aggccgcagt
     5821 gagaatcgtg gtctttactc ctgcatcgcc gagaactctc acggcagcga tcagtccagc
     5881 acaagcatcg atattgaacc ccgggagcgg ccgagtctta cgattgatac ggccacccaa
     5941 aaggtttcgg ttggctccca ggcgtccctt tactgtgccg cccagggcat tcccgaaccg
     6001 accgtcgagt gggttcgaac ggatggtcag ccactgtcgc cgcgtcacaa ggtccaggca
     6061 cccggctatg ttgtgatcga tgacattgtg ctcgatgata gcggtaccta cgagtgccgg
     6121 gcgagcaaca tagctggcca ggtgagcggc ttggccacca ttaacgtcca ggagccaact
     6181 cttgtgcgga tcgaaccaga taggcaacac catatcgtca cccagggcga cgaactctcg
     6241 ctcagctgcg tgggcagtgg cgtccctact ccttcggtct tttggagttt cgagggaaga
     6301 gacgttgaca ggatgggagt accggaaggt gctgtttttg cgcaaccttt ccgaaccaac
     6361 actgccgacg tgaaaatctt ccgggtgagc aaggagaacg aaggcatcta cgtctgtcac
     6421 ggatccaatg acgcgggtga agatcaacaa tacattcgcg tggaggtaca acccagacgg
     6481 ggtgacgtcg gtgcaggagg agatgacaat ggtgatgtcg atacccgaca gccccccaat
     6541 cggccccaaa tccaaccgaa tccattgagc aacgaacgcc tgaccaccga attgggcaac
     6601 aatgtgaccc tcatctgcaa cgtggacaac gtgaacacgg aatgggaacg cgtcgatggc
     6661 acacccctgc cgcacaatgc ctacacggtg agaaatacgc tggtgattgt cttcgtggag
     6721 ccgcagaatc tgggtcagta ccgctgcaat ggaatcggtc gcgatggacg tgtggaggcc
     6781 catgtggtga gggagctggt tctcctgccc ctgcccagga tcaccttcta tcccaacatc
     6841 ccgctgaccg tggagctggg ccagaacttg gatgtctact gccaggtgga gaacgtgcgt
     6901 ccggaggacg tgcattggac caccgacaac aatcgaccac tgcccagttc cgtacgcatc
     6961 gagggcaatg tcctcaggtt cgcgtccatc actcaggctg ctgccggtga ataccgctgc
     7021 tcggccacca atcaatatgg aagccgatcg aagaacgcca gggtggtggt gaaacagccc
     7081 agtggcttcc agcccgttcc ccactcgcag gtgcaacagc gtcaggtggg cgactccatc
     7141 cagttgcgat gccgcctgac cacccagtac ggcgacgagg ttcgcggcaa tatccagttc
     7201 aactggtacc gtgaggacgg cagccccttg ccccgcggtg tccgtccgga tagccaggtg
     7261 ctgcagctgg ttaaattgca gcccgaggac gagggccgct acatctgcaa ctcgtacgat
     7321 ttgggcagcg ggcagcaact gccccccgtc tccatcgact tgcaagtact aagaactact
     7381 acccagtatc ctttcaatcg gtttaagggc ggtgtctccc tgaaagacac gccctgcatg
     7441 gttctgtata tttgtgcagc ggtaccagcg gctccccaga accccatcta cctgccgcca
     7501 gtggcgccac cacgttcgcc cgaaaggatc ctcgagcccc aactgagcct gagtgtacaa
     7561 tcctcgaacc tgccagccgg cgacggcacc accgtcgagt gcttctcctc cgatgactcc
     7621 tacccagatg tcgtgtggga acgcgccgat ggagctccac tcagcgaaaa tgtccagcaa
     7681 gtgggcaata acctggtgat tagtaacgtg gcctccaccg atgccggtaa ctatgtgtgc
     7741 aagtgcaaga cggacgaggg agatctgtat accaccagct acaaactgga ggtcgaggag
     7801 cagccccatg aactgaagag ctccaagata gtctacgcca aggttggcgg aaatgccgac
     7861 ttgcagtgcg gagccgatga agatcgacag cccagctacc gttggtctcg ccaatacgga
     7921 caacttcagg cgggacgcag tctgcagaat gagaaacttt cgttggatcg cgttcaggcc
     7981 aacgatgccg gaacttatgt ttgttcggcc caatacagcg atggcgagac ggttgacttc
     8041 cccaacattc tggttgtgac cggggcgatt ccccagttcc gccaggagcc ccgcagctac
     8101 atgagcttcc ccacgctctc gaactcctcg ttcaagttca acttcgagct gaccttccgg
     8161 ccggaaaacg ccgacggact gctgctcttc aatggacaga cccgcggaag cggtgactat
     8221 atcgcactct cgctgaagga tcgctatgcg gagttccggt tcgattttgg cggtaaaccg
     8281 ttgctggtgc gagcggagga gccactggct ttggatgaat ggcacacggt gcgcgtgagt
     8341 cgcttcaagc gggatggcta catccaggtg gacgaccagc atccggtggc cttccccacc
     8401 tcccagcatc agcagatacc ccagttggaa ctgattgagg atctgtacat tggcggcgtg
     8461 cccaactggg agttcctgcc cgccgaggcg gtgggtcagc aatcaggctt cgtgggctgc
     8521 attagccggc tgaccctgca gggacgcacc gtggagctga tccgggaggc caagttcaag
     8581 gagggcatca ccgattgccg gccctgcgcc cagggaccct gccagaacaa gggcgtctgc
     8641 ctggagagcc agacggagca ggcctacacc tgcgtctgcc agccgggctg gactggccgg
     8701 gattgtgcca tcgagggcac ccagtgcacc gcaggagttt gcggctcggg acgctgcgag
     8761 aatacggaga acgacatgga gtgcctgtgc ccgctgaaca gggcaggcga tcgatgccag
     8821 tacaatgaga ttctaaatga acagagcttg aatttcaaga gcaacagctt tgcggcctac
     8881 ggaactccca aggtcaccaa agtaaacatc acactctccg ttcgtcccgc gagcctggag
     8941 gactctgtga tcctgtacac ggcggaatcc actctgccca gcggcgatta cctggctttg
     9001 gtccttcgcg gtggccacgc ggagctgctg atcaacacgg ccgcccgctt ggatcccgtg
     9061 gtggtgcgtt cggcggaacc gctgcccctc aatcgctgga ccagaatcga gatcaggcgt
     9121 cgcctgggcg agggaatcct caaggtgggc gatggacccg agcgaaaggc caaggcaccg
     9181 ggatccgatc gcattctgtc gctcaagacc cacctctttg tgggcggcgt cgatcggtcg
     9241 accgtaaaga tcaaccgtga tgtgaacatc accaagggct tcgatggctg catctcgaag
     9301 ctgtacaact cgcagaaatc cgtcaatctg ctgggtgaca tcagggatgc ggcgaatgtc
     9361 cagaactgtg gggaggcgaa tgagatagat gacgatgagt atgagatgcc agtagcgctg
     9421 ccatcgccta aggtcgccga gaatgaacgt cagctgatgg cgccgtgtgc cagtgatccc
     9481 tgcgagaacg ggggaagctg cagcgagcag gaggacatgg ccatctgctc ctgtcccttc
     9541 ggcttcagcg gcaaacactg ccagaatcac ctccagctga gcttcaatgc ctcgttccgc
     9601 ggcgatggct acgtggagct gaaccgcagc cacttccaac ccgccctgga gcagacgtac
     9661 tcccacattg gcattgtgtt caccaccaac aagccgaatg gcctgctttt ctggtggggc
     9721 caggaggccg gggaggagta caccggacag gacttcattg ccgccgccgt ggtcgatggc
     9781 tatgtggagt actcgatgag gctcgatggc gaggaggcgg tcattcggaa cagcgatatc
     9841 cgcgtggaca atggcgagcg gcacattgtg atcgccaagc gggatgagaa caccgccatg
     9901 ctggaactcg atcagatcct ggacacgggc gatacgcgac ccaccatcaa caaggcaatg
     9961 aagctgccgg gcaatgtgtt tgtcggtggc gctcctgatg tcgcggcatt cacgggcttc
    10021 cgctacaagg acaatttcaa cggctgcatt gtggtcgtcg agggcgaaac cgtgggccaa
    10081 attaacctta gttcagctgc catcaatgga gtgaatgcca acgtgtgtcc cgctaacgac
    10141 gaacctctgg gaggaaccga accgccagtc gtctgaggac acaaccagca accgaaatta
    10201 gctttttaat taaacattaa caaatgaaac aaaaagaaaa acaattttta tatatacaac
    10261 atatgaataa gccccaagca aacctacaaa aaattgaata ttatacgacg aacagataat
    10321 ataaaaacaa aaaaagagag aaacgatcac ttctactaca attgcttctt cgatccttaa
    10381 gtctaggtta aagattgtag caagaaaaca agcgaatatc acaaacattt atttaacaag
    10441 aacgccatgc gagaagtgaa acgaaacaga aacaataatg caattaatgc agataataca
    10501 gataaagcct agaaccctaa gaactaacta actaactcga acaagaacaa caacgcatac
    10561 tagccaactg caaccacaac aaccacaata gtgaaggcat tttaattata attttagtct
    10621 ctagcttata actatgacta cgactcgttt tttttgtgag cccagtgtaa aatgttggaa
    10681 atcggaaatt ggccctacac acaaacacac acaagttatt aattaaatac caattgatac
    10741 catataatga taaatgaaat actatgaatg caactattgt gaacgaacga aaaccgttga
    10801 gtggataaaa agcataagca gaagatatat taaaatgaaa tcaacaaca