Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218443 10849 bp mRNA linear INV 09-DEC-2024 (trol), transcript variant X31, mRNA. ACCESSION XM_070218443 VERSION XM_070218443.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..10849 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..10849 /gene="trol" /note="terribly reduced optic lobes; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:108055788" CDS 106..10176 /gene="trol" /codon_start=1 /product="basement membrane-specific heparan sulfate proteoglycan core protein isoform X31" /protein_id="XP_070074544.1" /db_xref="GeneID:108055788" /translation="MDCSDGSDEIACSSLSVLPCPQHQCPSGRCYSESERCDRHRHCE DGSDEANCCYADQFRCNNGDCIAESAHCDGNIDCSDQSDELDCGGDSQCLPNQFRCKN GQCVSSTARCNKRSDCLDGSDEQNCANEPNNSGRGTNQLKLKTYPDNQIIKESREVIF RCRDEGPNRAKVKWSRPGGRPLPPGFTDRNGRLEIPNIRVEDAGAYVCEAVGYANYIP GQHVTVNLNVERLNEREIRPDSACTEYQATCMNGECIDKSGICDGHPDCSDGSDEHSC SLGLKCQPNQFMCSNSKCVDRTWRCDGENDCGDNSDETSCDPEPSDAPCRYDEFQCRS GHCIPKSFQCDYMNDCTDGTDEIGCSVPSPMTLPAPSIVVMEYEVLELTCVGTGVPTP TIVWRLNWGHVPEKCESKSYGGTGTLRCPNMRPQDSGAYSCEFINTRGTFYPKTNSIV TVTPVRSDVCKAGFFNMLARKSEECVQCFCFGVSTNCDSANLFTYAIQPPILSHRVVS VELSPFRQIVINEASPGQDLLTLHHGVQFRASNVHYNGRETPFLALPAEYMGNQLKSY GGNLRYEVRYNGNGRPVSGPDVIITGNSFTLTHRVRTHPGQNNRVTIPFLPGGWTKPD GRKGTREDIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGSADQGLGSASLVEK CTCPPGYVGDSCESCASGYVRQARGPWLGHCVPFTPEPCPAGTYGNPRLGVPCQECPC PHAGANNFASGCQQSPDGDVICRCNEGYAGKRCEHCAQGYQGNPLAPGGVCRKIPDSS CNVDGTYNIYSNGTCQCKDSVIGEQCDTCAPKSFHLNSFTYTGCIECFCSGVGLDCDS SSWYRNQVTSTFGRTRVNHGFALISDYMRNTPVTVPVSMSTQANALSFVGSAEQAGNT LYWSLPAAFLGNKLTSYGGKLSYTLSYSPLPSGIMSRNSAPDVVIKSGEDLRLIHYRK SQVSPSVANTYAVEIKESAWQRGDELVPNREHVLMALSNITAIYIKATYTTSTKEASL RSVTLDTATATNLGTARAVEVEQCRCPEGYLGLSCEQCAPGYTRDPEAGIYLGLCRPC ECNGHSKYCNSETGECESCSDNTEGFNCDRCAAGYVGDATRGTSYDCQYDDGGYPTSR PPAPGNQTAECLVNCQQEGTAGCRGYQCECKRNVAGDRCDQCRPGTYGLSAQNPDGCK ECYCSGLTNQCRSASLYRQLIPVDFISTPPLITDEFGDIMDRDNLVPDVPRNVYTYKH TSYTPKYWSLRGSVLGNQLLSYGGRLEYSLIVESVGRDHRGKDVVLIGNGLKLIWSRP DGHDNEQEYHVRLHEDEQWTVEDRGSARQATRADFMTVLSDLQHILILATPKVPTVST SISNVILESSITTRAPGATHASDIELCQCPSGYTGTSCESCAPLHYRDASGRCSQCPC DASNTESCGLVSGGNVECQCRPRWRGDRCREIDTSPIIEEPPQICDLSRGFCCSGFQF DIAPNETISFNDTLQIYKGNRIIGNMTKLRYGCPSRETNEPTPEPDTSTDDPVRTQII VSIARPEITILPVGGSLTLSCTGRMRWTNSPVFVNWYKQGSHLPEGVEVQGGNLQLFN LQISDSGIYICQAVSNETGHSFTDHVSITVSQEDQRSPAHIVDLPNDVTFEEYVSNEI VCEVEGNPPPTVTWTRVDGHADAQSTRTDNNRLVFDSPRKSDEGRYRCQAENSLSREE KYVVVYVRSNPPQPPPQQDRLYITPQEVNGVAGDSFQLSCQFTSAASLRYDWSHDGRS LSASSPRNVVVRGNVLEVRDANVRDSGTYTCVAFDLRTRRNFTESARVYIEQPNEPGI LGDKPHILTLEQNIIIVQGEDLSITCEASGTPYPSIKWTKVQENLAENVRISGNVLTI YGGRSENRGLYSCIAENSHGSDQSSTSIDIEPRERPSLTIDTATQKVSVGSQASLYCA AQGIPEPTVEWVRTDGQPLSPRHKVQAPGYVVIDDIVLDDSGTYECRASNIAGQVSGL ATINVQEPTLVRIEPDRQHHIVTQGDELSLSCVGSGVPTPSVFWSFEGRDVDRMGVPE GAVFAQPFRTNTADVKIFRVSKENEGIYVCHGSNDAGEDQQYIRVEVQPRRGDVGAGG DDNGDVDTRQPPNRPQIQPNPLSNERLTTELGNNVTLICNVDNVNTEWERVDGTPLPH NAYTVRNTLVIVFVEPQNLGQYRCNGIGRDGRVEAHVVRELVLLPLPRITFYPNIPLT VELGQNLDVYCQVENVRPEDVHWTTDNNRPLPSSVRIEGNVLRFASITQAAAGEYRCS ATNQYGSRSKNARVVVKQPSGFQPVPHSQVQQRQVGDSIQLRCRLTTQYGDEVRGNIQ FNWYREDGSPLPRGVRPDSQVLQLVKLQPEDEGRYICNSYDLGSGQQLPPVSIDLQVL RTTTQYPFNRFKGGVSLKDTPCMVLYICAAVPAAPQNPIYLPPVAPPRSPERILEPQL SLSVQSSNLPAGDGTTVECFSSDDSYPDVVWERADGAPLSENVQQVGNNLVISNVAST DAGNYVCKCKTDEGDLYTTSYKLEVEEQPHELKSSKIVYAKVGGNADLQCGADEDRQP SYRWSRQYGQLQAGRSLQNEKLSLDRVQANDAGTYVCSAQYSDGETVDFPNILVVTGA IPQFRQEPRSYMSFPTLSNSSFKFNFELTFRPENADGLLLFNGQTRGSGDYIALSLKD RYAEFRFDFGGKPLLVRAEEPLALDEWHTVRVSRFKRDGYIQVDDQHPVAFPTSQHQQ IPQLELIEDLYIGGVPNWEFLPAEAVGQQSGFVGCISRLTLQGRTVELIREAKFKEGI TDCRPCAQGPCQNKGVCLESQTEQAYTCVCQPGWTGRDCAIEGTQCTAGVCGSGRCEN TENDMECLCPLNRAGDRCQYNEILNEQSLNFKSNSFAAYGTPKVTKVNITLSVRPASL EDSVILYTAESTLPSGDYLALVLRGGHAELLINTAARLDPVVVRSAEPLPLNRWTRIE IRRRLGEGILKVGDGPERKAKAPGSDRILSLKTHLFVGGVDRSTVKINRDVNITKGFD GCISKLYNSQKSVNLLGDIRDAANVQNCGEANEIDDDEYEMPVALPSPKVAENERQLM APCASDPCENGGSCSEQEDMAICSCPFGFSGKHCQNHLQLSFNASFRGDGYVELNRSH FQPALEQTYSHIGIVFTTNKPNGLLFWWGQEAGEEYTGQDFIAAAVVDGYVEYSMRLD GEEAVIRNSDIRVDNGERHIVIAKRDENTAMLELDQILDTGDTRPTINKAMKLPGNVF VGGAPDVAAFTGFRYKDNFNGCIVVVEGETVGQINLSSAAINGVNANVCPANDEPLGG TEPPVV" misc_feature 169..261 /gene="trol" /note="Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about...; Region: LDLa; cd00112" /db_xref="CDD:238060" misc_feature order(172..174,196..198,229..234) /gene="trol" /note="putative binding surface [active]" /db_xref="CDD:238060" misc_feature order(208..210,217..219,229..231,247..252) /gene="trol" /note="calcium-binding site [ion binding]; other site" /db_xref="CDD:238060" misc_feature 238..252 /gene="trol" /note="D-X-S-D-E motif; other site" /db_xref="CDD:238060" misc_feature 262..366 /gene="trol" /note="Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about...; Region: LDLa; cd00112" /db_xref="CDD:238060" misc_feature order(277..279,301..303,334..339) /gene="trol" /note="putative binding surface [active]" /db_xref="CDD:238060" misc_feature order(313..315,322..324,334..336,352..357) /gene="trol" /note="calcium-binding site [ion binding]; other site" /db_xref="CDD:238060" misc_feature 343..357 /gene="trol" /note="D-X-S-D-E motif; other site" /db_xref="CDD:238060" misc_feature 382..486 /gene="trol" /note="Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about...; Region: LDLa; cd00112" /db_xref="CDD:238060" misc_feature order(397..399,421..423,454..459) /gene="trol" /note="putative binding surface [active]" /db_xref="CDD:238060" misc_feature order(433..435,442..444,454..456,472..477) /gene="trol" /note="calcium-binding site [ion binding]; other site" /db_xref="CDD:238060" misc_feature 463..477 /gene="trol" /note="D-X-S-D-E motif; other site" /db_xref="CDD:238060" misc_feature 529..735 /gene="trol" /note="Immunoglobulin domain; Region: Ig_3; pfam13927" /db_xref="CDD:464046" misc_feature 829..933 /gene="trol" /note="Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about...; Region: LDLa; cd00112" /db_xref="CDD:238060" misc_feature order(844..846,868..870,901..906) /gene="trol" /note="putative binding surface [active]" /db_xref="CDD:238060" misc_feature order(880..882,889..891,901..903,919..924) /gene="trol" /note="calcium-binding site [ion binding]; other site" /db_xref="CDD:238060" misc_feature 910..924 /gene="trol" /note="D-X-S-D-E motif; other site" /db_xref="CDD:238060" misc_feature 949..1053 /gene="trol" /note="Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about...; Region: LDLa; cd00112" /db_xref="CDD:238060" misc_feature order(964..966,988..990,1021..1026) /gene="trol" /note="putative binding surface [active]" /db_xref="CDD:238060" misc_feature order(1000..1002,1009..1011,1021..1023,1039..1044) /gene="trol" /note="calcium-binding site [ion binding]; other site" /db_xref="CDD:238060" misc_feature 1030..1044 /gene="trol" /note="D-X-S-D-E motif; other site" /db_xref="CDD:238060" misc_feature 1078..1182 /gene="trol" /note="Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about...; Region: LDLa; cd00112" /db_xref="CDD:238060" misc_feature order(1093..1095,1117..1119,1150..1155) /gene="trol" /note="putative binding surface [active]" /db_xref="CDD:238060" misc_feature order(1129..1131,1138..1140,1150..1152,1168..1173) /gene="trol" /note="calcium-binding site [ion binding]; other site" /db_xref="CDD:238060" misc_feature 1159..1173 /gene="trol" /note="D-X-S-D-E motif; other site" /db_xref="CDD:238060" misc_feature 1234..1461 /gene="trol" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 1243..1257 /gene="trol" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 1282..1296 /gene="trol" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 1351..1365 /gene="trol" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 1393..1410 /gene="trol" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 1435..1446 /gene="trol" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 1756..2148 /gene="trol" /note="Laminin B (Domain IV); Region: Laminin_B; pfam00052" /db_xref="CDD:459652" misc_feature 2317..2478 /gene="trol" /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053" /db_xref="CDD:395007" misc_feature order(2317..2319,2323..2325,2359..2361,2389..2391, 2395..2397,2422..2424) /gene="trol" /note="EGF-like motif [active]" /db_xref="CDD:238012" misc_feature 2497..2610 /gene="trol" /note="Laminin-type epidermal growth factor-like domai; Region: EGF_Lam; smart00180" /db_xref="CDD:214543" misc_feature 2851..3261 /gene="trol" /note="Laminin B (Domain IV); Region: Laminin_B; pfam00052" /db_xref="CDD:459652" misc_feature <3262..3342 /gene="trol" /note="Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in...; Region: EGF_Lam; cd00055" /db_xref="CDD:238012" misc_feature 3364..3513 /gene="trol" /note="Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in...; Region: EGF_Lam; cd00055" /db_xref="CDD:238012" misc_feature order(3367..3369,3373..3375,3394..3396,3415..3417, 3424..3426,3451..3453) /gene="trol" /note="EGF-like motif [active]" /db_xref="CDD:238012" misc_feature <3622..3714 /gene="trol" /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053" /db_xref="CDD:395007" misc_feature 3910..4314 /gene="trol" /note="Laminin B (Domain IV); Region: Laminin_B; pfam00052" /db_xref="CDD:459652" misc_feature 4777..5025 /gene="trol" /note="Immunoglobulin like; Region: IG_like; smart00410" /db_xref="CDD:214653" misc_feature 4810..4824 /gene="trol" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 4858..4872 /gene="trol" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 4915..4929 /gene="trol" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 4957..4974 /gene="trol" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 5002..5013 /gene="trol" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature <5104..5265 /gene="trol" /note="Immunoglobulin domain; Region: Ig_3; pfam13927" /db_xref="CDD:464046" misc_feature 5356..5607 /gene="trol" /note="Immunoglobulin like; Region: IG_like; smart00410" /db_xref="CDD:214653" misc_feature 5389..5403 /gene="trol" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 5428..5442 /gene="trol" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 5497..5511 /gene="trol" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 5539..5556 /gene="trol" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 5644..5886 /gene="trol" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 5695..5709 /gene="trol" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409570" misc_feature 5734..5748 /gene="trol" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409570" misc_feature 5791..5805 /gene="trol" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409570" misc_feature 5833..5850 /gene="trol" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409570" misc_feature 5872..5883 /gene="trol" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409570" misc_feature 5938..6168 /gene="trol" /note="Immunoglobulin I-set domain; Region: I-set; pfam07679" /db_xref="CDD:400151" misc_feature 5962..5976 /gene="trol" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 6001..6015 /gene="trol" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 6106..6123 /gene="trol" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 6145..6156 /gene="trol" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 6205..6468 /gene="trol" /note="Immunoglobulin like; Region: IG_like; smart00410" /db_xref="CDD:214653" misc_feature 6235..6249 /gene="trol" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 6274..6288 /gene="trol" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 6406..6423 /gene="trol" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 6841..7071 /gene="trol" /note="Immunoglobulin like; Region: IG_like; smart00410" /db_xref="CDD:214653" misc_feature 6868..6882 /gene="trol" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 6907..6921 /gene="trol" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 6967..6981 /gene="trol" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 7009..7026 /gene="trol" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 7105..>7308 /gene="trol" /note="Immunoglobulin like; Region: IG_like; smart00410" /db_xref="CDD:214653" misc_feature 7138..7152 /gene="trol" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 7186..7209 /gene="trol" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 7255..7269 /gene="trol" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 7555..7761 /gene="trol" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 7627..7641 /gene="trol" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 7690..7701 /gene="trol" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 7729..7746 /gene="trol" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 7831..8031 /gene="trol" /note="Immunoglobulin like; Region: IG_like; smart00410" /db_xref="CDD:214653" misc_feature 7855..7869 /gene="trol" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 7894..7908 /gene="trol" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 7951..7965 /gene="trol" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 7993..8010 /gene="trol" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 8095..8538 /gene="trol" /note="Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans. Proteins that contain LamG domains serve a variety of...; Region: LamG; cd00110" /db_xref="CDD:238058" misc_feature 8605..8703 /gene="trol" /note="EGF-like domain; Region: EGF; pfam00008" /db_xref="CDD:394967" misc_feature 8845..9306 /gene="trol" /note="Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans. Proteins that contain LamG domains serve a variety of...; Region: LamG; cd00110" /db_xref="CDD:238058" misc_feature 9466..9564 /gene="trol" /note="Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the...; Region: EGF_CA; cd00054" /db_xref="CDD:238011" misc_feature 9589..10050 /gene="trol" /note="Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans. Proteins that contain LamG domains serve a variety of...; Region: LamG; cd00110" /db_xref="CDD:238058" polyA_site 10849 /gene="trol" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 caatcggaag cagccaccac acgactaaag cccagcgact gcggtccgga tcagttcttc 61 tgcgatgatt tatgctataa tcgctctatt cgatgcaatg gccatatgga ttgctcagat 121 ggcagtgatg agatcgcttg tagctcgctg tcagtgcttc catgtccaca gcaccagtgt 181 cccagtggca ggtgttattc ggaaagtgag cgatgcgatc gccacaggca ctgcgaggat 241 ggctccgatg aggccaactg ctgttacgcg gatcaattcc gctgcaataa tggtgactgc 301 attgcggaat cggctcattg cgatggaaat atcgattgta gcgaccagtc cgatgaactc 361 gactgcggag gagactcgca gtgtctgccc aaccaattcc gctgcaagaa tggccaatgt 421 gtgagctcta cagcgcgttg caacaagcgt tccgattgtt tggatggctc cgatgagcag 481 aattgtgcca atgaacctaa caactccgga cgtggaacga accaattgaa actcaagacc 541 tatcccgaca accaaatcat taaggagagt cgtgaggtca tcttccgttg ccgtgacgaa 601 ggtcccaacc gcgccaaggt caagtggtcg cgacccggcg gacgtcccct gccccccggt 661 ttcaccgatc gcaatggccg cctggagatc cccaacatca gggtggagga tgctggcgcc 721 tatgtctgcg aggccgtggg ctatgccaac tatattcccg gtcagcacgt caccgtaaac 781 ctcaacgtcg agcgcttaaa cgaacgcgaa atccgtccgg actcagcctg tacggagtac 841 caggccacct gcatgaacgg cgagtgtatc gataagtcgg gcatctgcga tggacatccg 901 gactgttcgg atggctccga tgagcacagc tgcagtttgg gtttgaagtg tcagcccaac 961 cagttcatgt gctccaattc caagtgtgtg gatcgcacct ggcgctgtga tggcgagaac 1021 gactgcggcg ataactccga tgagacctct tgcgatccgg aaccaagtga tgctccgtgc 1081 cgatacgacg aattccagtg ccgcagcggt cattgcattc ccaagagctt ccagtgcgac 1141 tatatgaacg attgtaccga tggtaccgat gaaattggat gctcggtgcc ctctccaatg 1201 accctacccg caccctcgat tgtcgtgatg gagtacgagg tcctcgagct gacctgcgtg 1261 ggcaccggcg tcccgacgcc gacgatcgtg tggcgtctca actggggcca tgtgcccgag 1321 aagtgtgaat cgaagagcta cggcggaacc ggaaccctgc gctgtccgaa catgaggccc 1381 caggacagtg gtgcctactc gtgcgagttc atcaacacac gcggcacctt ctatccgaaa 1441 acgaactcga ttgtcaccgt tacgccggtg cgctcggatg tctgcaaggc cggattcttc 1501 aatatgctgg cccgcaagtc ggaggaatgc gtccagtgct tctgctttgg cgtttcgacc 1561 aactgtgaca gtgccaattt gttcacctac gccattcagc caccgatcct ttcgcaccgc 1621 gtggtcagcg ttgaactcag tccgttccgt caaattgtca tcaatgaggc tagtccgggt 1681 caggatctgc tcaccttgca ccatggtgtt cagttcaggg catcgaacgt acactacaac 1741 ggccgggaga caccattctt ggccctgccc gctgagtata tgggcaacca gctgaagtcc 1801 tatggcggca atctgcgcta cgaggtcagg tacaatggca acggtagacc ggtcagcgga 1861 cccgatgtca tcatcaccgg caacagtttc acgctaaccc atcgcgttcg cactcatccg 1921 ggtcagaaca acagggtgac tattcccttc ctgccgggag gctggacgaa gccggatggt 1981 cgcaagggaa cgcgagagga catcatgatg atactggcca atgtggacaa tattctgatt 2041 cgactgggct acctggatag cacagctcgc gaagtggatc tgataaatat cgccttggat 2101 tcggccggaa gtgccgatca gggattgggc agtgcctcgc tcgtggagaa gtgcacctgt 2161 ccgcccggct atgttggtga ttcgtgcgag tcctgtgcct cgggctatgt tcgccaggcc 2221 cgcggacctt ggctgggtca ttgtgtgccc ttcaccccgg aaccgtgccc agcgggaacc 2281 tacggcaatc cccgacttgg tgttccctgc caggagtgtc cgtgccccca cgcgggcgcc 2341 aataactttg ccagcggctg ccaacagagt cccgatggcg atgtgatttg ccgctgcaac 2401 gaaggctatg ccggcaagag gtgcgagcac tgcgcccagg gttaccaggg taatccgttg 2461 gcaccgggag gagtctgtcg caagataccc gatagttcgt gcaatgtcga cggcacctac 2521 aacatctaca gcaatggaac gtgccagtgc aaggatagcg tgattggcga acagtgcgac 2581 acctgcgcgc cgaagagttt ccacctcaat tcgttcacct acaccggttg catcgagtgc 2641 ttctgcagtg gagtgggctt ggattgtgac agtagttcgt ggtatcgcaa ccaggtcacc 2701 agcacctttg gacgaacgcg cgtcaatcat ggattcgccc tgattagcga ctatatgcgc 2761 aataccccgg taacggtgcc cgtttccatg tccacccagg ccaatgcctt gagcttcgtg 2821 ggatccgccg agcaggccgg taatacgctc tactggagtc ttcccgccgc cttcctgggc 2881 aacaagctga cctcgtacgg aggcaagttg agctacacgc tcagctacag tcccctgccc 2941 agcggcatta tgtcgcgcaa cagtgccccc gatgtggtga tcaagagcgg cgaggatctg 3001 aggctcatcc attacaggaa gtcgcaggtc agtcccagtg tggccaacac ctatgccgtg 3061 gagatcaagg agagcgcatg gcagcgcggc gatgaactgg tgcctaaccg tgaacacgtc 3121 ctgatggccc tcagcaatat tacggccatc tatatcaagg ccacgtacac gactagcacc 3181 aaggaggcct cgctgcgatc ggtcacattg gatacggcca cggccaccaa tctgggcacc 3241 gcacgtgccg tcgaagtgga gcagtgccgc tgtcccgagg gctatttggg tctctcctgc 3301 gagcagtgtg ctcctggcta tacgcgcgat ccggaggcag gaatctatct gggtctctgc 3361 aggccctgcg agtgcaatgg acattccaag tattgcaaca gtgagacagg cgaatgcgaa 3421 agctgttccg acaacaccga aggattcaat tgtgaccgat gcgccgccgg ctatgtgggt 3481 gatgccaccc gaggaacttc gtacgactgt caatacgatg acggcggcta tccgacgtcg 3541 cgtccaccgg caccgggcaa tcagacggcc gaatgcctgg tgaattgcca acaggaggga 3601 accgccggtt gccgcggcta ccagtgcgag tgcaagagga atgtggctgg cgatcgatgc 3661 gatcagtgcc gccccggaac ctatggactg tcggcccaaa atccggacgg ttgcaaggag 3721 tgctactgct ccggactgac caaccagtgc cgctcggcgt ctctctaccg ccagctgata 3781 cccgtggact tcatttcgac gccaccattg ataacagacg aattcggcga catcatggat 3841 agggataacc ttgtgcccga cgtgcccagg aatgtgtata cctacaagca cacctcctac 3901 acgcccaagt actggagcct gaggggtagt gtgctgggca accagctgtt gtcgtacggc 3961 ggccgcttgg agtacagcct gattgtggag tccgttggcc gggaccatcg tggcaaggat 4021 gtggtcctaa ttggcaacgg actcaagctg atctggtcgc gacccgatgg ccatgacaac 4081 gagcaggaat accatgtgcg tttgcatgag gacgagcagt ggacggttga ggatcgtgga 4141 tcggcacgac aggccacgcg ggccgacttc atgactgtgc tgtcggatct gcagcacatc 4201 ctgatcctgg ccacacccaa ggtgcccacg gtcagcacct cgattagcaa tgtcatcctg 4261 gagagttcga taaccacgag agcgcctgga gctacgcatg cctccgatat cgagttgtgc 4321 cagtgtccat ccggttatac gggcacttcc tgtgagtcct gcgcaccact gcactaccgc 4381 gacgcctctg gacgctgcag tcagtgtcct tgcgacgctt ccaacacgga atcctgcggc 4441 ttggtcagcg gcggtaacgt cgaatgccag tgcaggccac gctggagggg tgatcgctgc 4501 cgggaaattg acacatcgcc cattatcgaa gaaccgcccc agatatgtga tttaagcagg 4561 ggattctgtt gcagcggctt tcagttcgat atcgcaccga acgagacaat ctcgtttaat 4621 gacaccctgc agatatataa gggcaacaga atcataggaa atatgaccaa gctgcgctac 4681 ggctgtccat cgcgagaaac taacgaaccg actccggaac cggataccag taccgatgat 4741 cccgtgcgca cccagatcat agtgtcgatt gccaggccag agattaccat tctgcccgtg 4801 ggtggatcgc tgaccctcag ctgtaccggt cgaatgcgct ggaccaatag cccagtgttt 4861 gtgaactggt acaagcaggg cagtcacctg cccgagggag tcgaggtgca aggcggtaat 4921 ctgcagctgt tcaacctgca gatcagcgat tctggaatct acatctgcca ggccgtaagc 4981 aacgagaccg gccacagctt tacggaccac gtctccatca ccgtttccca ggaggaccaa 5041 cgctcgccgg ctcacattgt ggatttgccc aacgacgtga ccttcgagga gtacgtaagc 5101 aatgagatcg tctgcgaggt ggagggcaac ccaccaccca ctgtcacctg gactcgcgtg 5161 gatggccatg cggacgccca aagtacgcga acggacaaca atcggctggt cttcgattcg 5221 ccgaggaaat cggacgaggg tcgctatcgc tgccaggcag agaatagcct gagtcgggag 5281 gagaagtacg tagtcgtgta tgtccggagc aatcctcccc agccgccgcc gcagcaggat 5341 cgtttgtaca tcacaccgca ggaggtgaac ggtgtggccg gtgactcctt ccagttgtcc 5401 tgccaattca ccagcgctgc ctctctgcgc tacgattggt cccacgatgg tcgctccctg 5461 tccgcgtcgt caccccgaaa tgttgtggtc cgcggaaatg tcctggaagt ccgcgatgcc 5521 aacgttcgcg actccggcac ctacacctgt gtggccttcg acctgcgcac ccgacgcaac 5581 ttcaccgaga gcgcacgggt ctacatcgag cagcccaacg agccgggaat ccttggcgac 5641 aagccgcata tcttgacctt ggagcagaac atcataattg tgcaaggcga ggacttgagc 5701 atcacatgtg aggcaagtgg aacgccctat ccctcgatta agtggaccaa ggtgcaggag 5761 aatctggccg aaaatgtccg catcagtggc aatgtgctca ccatctacgg aggccgcagt 5821 gagaatcgtg gtctttactc ctgcatcgcc gagaactctc acggcagcga tcagtccagc 5881 acaagcatcg atattgaacc ccgggagcgg ccgagtctta cgattgatac ggccacccaa 5941 aaggtttcgg ttggctccca ggcgtccctt tactgtgccg cccagggcat tcccgaaccg 6001 accgtcgagt gggttcgaac ggatggtcag ccactgtcgc cgcgtcacaa ggtccaggca 6061 cccggctatg ttgtgatcga tgacattgtg ctcgatgata gcggtaccta cgagtgccgg 6121 gcgagcaaca tagctggcca ggtgagcggc ttggccacca ttaacgtcca ggagccaact 6181 cttgtgcgga tcgaaccaga taggcaacac catatcgtca cccagggcga cgaactctcg 6241 ctcagctgcg tgggcagtgg cgtccctact ccttcggtct tttggagttt cgagggaaga 6301 gacgttgaca ggatgggagt accggaaggt gctgtttttg cgcaaccttt ccgaaccaac 6361 actgccgacg tgaaaatctt ccgggtgagc aaggagaacg aaggcatcta cgtctgtcac 6421 ggatccaatg acgcgggtga agatcaacaa tacattcgcg tggaggtaca acccagacgg 6481 ggtgacgtcg gtgcaggagg agatgacaat ggtgatgtcg atacccgaca gccccccaat 6541 cggccccaaa tccaaccgaa tccattgagc aacgaacgcc tgaccaccga attgggcaac 6601 aatgtgaccc tcatctgcaa cgtggacaac gtgaacacgg aatgggaacg cgtcgatggc 6661 acacccctgc cgcacaatgc ctacacggtg agaaatacgc tggtgattgt cttcgtggag 6721 ccgcagaatc tgggtcagta ccgctgcaat ggaatcggtc gcgatggacg tgtggaggcc 6781 catgtggtga gggagctggt tctcctgccc ctgcccagga tcaccttcta tcccaacatc 6841 ccgctgaccg tggagctggg ccagaacttg gatgtctact gccaggtgga gaacgtgcgt 6901 ccggaggacg tgcattggac caccgacaac aatcgaccac tgcccagttc cgtacgcatc 6961 gagggcaatg tcctcaggtt cgcgtccatc actcaggctg ctgccggtga ataccgctgc 7021 tcggccacca atcaatatgg aagccgatcg aagaacgcca gggtggtggt gaaacagccc 7081 agtggcttcc agcccgttcc ccactcgcag gtgcaacagc gtcaggtggg cgactccatc 7141 cagttgcgat gccgcctgac cacccagtac ggcgacgagg ttcgcggcaa tatccagttc 7201 aactggtacc gtgaggacgg cagccccttg ccccgcggtg tccgtccgga tagccaggtg 7261 ctgcagctgg ttaaattgca gcccgaggac gagggccgct acatctgcaa ctcgtacgat 7321 ttgggcagcg ggcagcaact gccccccgtc tccatcgact tgcaagtact aagaactact 7381 acccagtatc ctttcaatcg gtttaagggc ggtgtctccc tgaaagacac gccctgcatg 7441 gttctgtata tttgtgcagc ggtaccagcg gctccccaga accccatcta cctgccgcca 7501 gtggcgccac cacgttcgcc cgaaaggatc ctcgagcccc aactgagcct gagtgtacaa 7561 tcctcgaacc tgccagccgg cgacggcacc accgtcgagt gcttctcctc cgatgactcc 7621 tacccagatg tcgtgtggga acgcgccgat ggagctccac tcagcgaaaa tgtccagcaa 7681 gtgggcaata acctggtgat tagtaacgtg gcctccaccg atgccggtaa ctatgtgtgc 7741 aagtgcaaga cggacgaggg agatctgtat accaccagct acaaactgga ggtcgaggag 7801 cagccccatg aactgaagag ctccaagata gtctacgcca aggttggcgg aaatgccgac 7861 ttgcagtgcg gagccgatga agatcgacag cccagctacc gttggtctcg ccaatacgga 7921 caacttcagg cgggacgcag tctgcagaat gagaaacttt cgttggatcg cgttcaggcc 7981 aacgatgccg gaacttatgt ttgttcggcc caatacagcg atggcgagac ggttgacttc 8041 cccaacattc tggttgtgac cggggcgatt ccccagttcc gccaggagcc ccgcagctac 8101 atgagcttcc ccacgctctc gaactcctcg ttcaagttca acttcgagct gaccttccgg 8161 ccggaaaacg ccgacggact gctgctcttc aatggacaga cccgcggaag cggtgactat 8221 atcgcactct cgctgaagga tcgctatgcg gagttccggt tcgattttgg cggtaaaccg 8281 ttgctggtgc gagcggagga gccactggct ttggatgaat ggcacacggt gcgcgtgagt 8341 cgcttcaagc gggatggcta catccaggtg gacgaccagc atccggtggc cttccccacc 8401 tcccagcatc agcagatacc ccagttggaa ctgattgagg atctgtacat tggcggcgtg 8461 cccaactggg agttcctgcc cgccgaggcg gtgggtcagc aatcaggctt cgtgggctgc 8521 attagccggc tgaccctgca gggacgcacc gtggagctga tccgggaggc caagttcaag 8581 gagggcatca ccgattgccg gccctgcgcc cagggaccct gccagaacaa gggcgtctgc 8641 ctggagagcc agacggagca ggcctacacc tgcgtctgcc agccgggctg gactggccgg 8701 gattgtgcca tcgagggcac ccagtgcacc gcaggagttt gcggctcggg acgctgcgag 8761 aatacggaga acgacatgga gtgcctgtgc ccgctgaaca gggcaggcga tcgatgccag 8821 tacaatgaga ttctaaatga acagagcttg aatttcaaga gcaacagctt tgcggcctac 8881 ggaactccca aggtcaccaa agtaaacatc acactctccg ttcgtcccgc gagcctggag 8941 gactctgtga tcctgtacac ggcggaatcc actctgccca gcggcgatta cctggctttg 9001 gtccttcgcg gtggccacgc ggagctgctg atcaacacgg ccgcccgctt ggatcccgtg 9061 gtggtgcgtt cggcggaacc gctgcccctc aatcgctgga ccagaatcga gatcaggcgt 9121 cgcctgggcg agggaatcct caaggtgggc gatggacccg agcgaaaggc caaggcaccg 9181 ggatccgatc gcattctgtc gctcaagacc cacctctttg tgggcggcgt cgatcggtcg 9241 accgtaaaga tcaaccgtga tgtgaacatc accaagggct tcgatggctg catctcgaag 9301 ctgtacaact cgcagaaatc cgtcaatctg ctgggtgaca tcagggatgc ggcgaatgtc 9361 cagaactgtg gggaggcgaa tgagatagat gacgatgagt atgagatgcc agtagcgctg 9421 ccatcgccta aggtcgccga gaatgaacgt cagctgatgg cgccgtgtgc cagtgatccc 9481 tgcgagaacg ggggaagctg cagcgagcag gaggacatgg ccatctgctc ctgtcccttc 9541 ggcttcagcg gcaaacactg ccagaatcac ctccagctga gcttcaatgc ctcgttccgc 9601 ggcgatggct acgtggagct gaaccgcagc cacttccaac ccgccctgga gcagacgtac 9661 tcccacattg gcattgtgtt caccaccaac aagccgaatg gcctgctttt ctggtggggc 9721 caggaggccg gggaggagta caccggacag gacttcattg ccgccgccgt ggtcgatggc 9781 tatgtggagt actcgatgag gctcgatggc gaggaggcgg tcattcggaa cagcgatatc 9841 cgcgtggaca atggcgagcg gcacattgtg atcgccaagc gggatgagaa caccgccatg 9901 ctggaactcg atcagatcct ggacacgggc gatacgcgac ccaccatcaa caaggcaatg 9961 aagctgccgg gcaatgtgtt tgtcggtggc gctcctgatg tcgcggcatt cacgggcttc 10021 cgctacaagg acaatttcaa cggctgcatt gtggtcgtcg agggcgaaac cgtgggccaa 10081 attaacctta gttcagctgc catcaatgga gtgaatgcca acgtgtgtcc cgctaacgac 10141 gaacctctgg gaggaaccga accgccagtc gtctgaggac acaaccagca accgaaatta 10201 gctttttaat taaacattaa caaatgaaac aaaaagaaaa acaattttta tatatacaac 10261 atatgaataa gccccaagca aacctacaaa aaattgaata ttatacgacg aacagataat 10321 ataaaaacaa aaaaagagag aaacgatcac ttctactaca attgcttctt cgatccttaa 10381 gtctaggtta aagattgtag caagaaaaca agcgaatatc acaaacattt atttaacaag 10441 aacgccatgc gagaagtgaa acgaaacaga aacaataatg caattaatgc agataataca 10501 gataaagcct agaaccctaa gaactaacta actaactcga acaagaacaa caacgcatac 10561 tagccaactg caaccacaac aaccacaata gtgaaggcat tttaattata attttagtct 10621 ctagcttata actatgacta cgactcgttt tttttgtgag cccagtgtaa aatgttggaa 10681 atcggaaatt ggccctacac acaaacacac acaagttatt aattaaatac caattgatac 10741 catataatga taaatgaaat actatgaatg caactattgt gaacgaacga aaaccgttga 10801 gtggataaaa agcataagca gaagatatat taaaatgaaa tcaacaaca