Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218442 11001 bp mRNA linear INV 09-DEC-2024 (trol), transcript variant X30, mRNA. ACCESSION XM_070218442 VERSION XM_070218442.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..11001 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..11001 /gene="trol" /note="terribly reduced optic lobes; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:108055788" CDS 198..10328 /gene="trol" /codon_start=1 /product="basement membrane-specific heparan sulfate proteoglycan core protein isoform X30" /protein_id="XP_070074543.1" /db_xref="GeneID:108055788" /translation="MGRRLRAAFWLLAALIVIEKPQKSIARGTYVAYGECRATEFRCN NGDCIDIRKRCDHISDCSEGEDENEECRCYADQFRCNNGDCIAESAHCDGNIDCSDQS DELDCGGDSQCLPNQFRCKNGQCVSSTARCNKRSDCLDGSDEQNCANEPNNSGRGTNQ LKLKTYPDNQIIKESREVIFRCRDEGPNRAKVKWSRPGGRPLPPGFTDRNGRLEIPNI RVEDAGAYVCEAVGYANYIPGQHVTVNLNVERLNEREIRPDSACTEYQATCMNGECID KSGICDGHPDCSDGSDEHSCSLGLKCQPNQFMCSNSKCVDRTWRCDGENDCGDNSDET SCDPEPSDAPCRYDEFQCRSGHCIPKSFQCDYMNDCTDGTDEIGCSVPSPMTLPAPSI VVMEYEVLELTCVGTGVPTPTIVWRLNWGHVPEKCESKSYGGTGTLRCPNMRPQDSGA YSCEFINTRGTFYPKTNSIVTVTPVRSDVCKAGFFNMLARKSEECVQCFCFGVSTNCD SANLFTYAIQPPILSHRVVSVELSPFRQIVINEASPGQDLLTLHHGVQFRASNVHYNG RETPFLALPAEYMGNQLKSYGGNLRYEVRYNGNGRPVSGPDVIITGNSFTLTHRVRTH PGQNNRVTIPFLPGGWTKPDGRKGTREDIMMILANVDNILIRLGYLDSTAREVDLINI ALDSAGSADQGLGSASLVEKCTCPPGYVGDSCESCASGYVRQARGPWLGHCVPFTPEP CPAGTYGNPRLGVPCQECPCPHAGANNFASGCQQSPDGDVICRCNEGYAGKRCEHCAQ GYQGNPLAPGGVCRKIPDSSCNVDGTYNIYSNGTCQCKDSVIGEQCDTCAPKSFHLNS FTYTGCIECFCSGVGLDCDSSSWYRNQVTSTFGRTRVNHGFALISDYMRNTPVTVPVS MSTQANALSFVGSAEQAGNTLYWSLPAAFLGNKLTSYGGKLSYTLSYSPLPSGIMSRN SAPDVVIKSGEDLRLIHYRKSQVSPSVANTYAVEIKESAWQRGDELVPNREHVLMALS NITAIYIKATYTTSTKEASLRSVTLDTATATNLGTARAVEVEQCRCPEGYLGLSCEQC APGYTRDPEAGIYLGLCRPCECNGHSKYCNSETGECESCSDNTEGFNCDRCAAGYVGD ATRGTSYDCQYDDGGYPTSRPPAPGNQTAECLVNCQQEGTAGCRGYQCECKRNVAGDR CDQCRPGTYGLSAQNPDGCKECYCSGLTNQCRSASLYRQLIPVDFISTPPLITDEFGD IMDRDNLVPDVPRNVYTYKHTSYTPKYWSLRGSVLGNQLLSYGGRLEYSLIVESVGRD HRGKDVVLIGNGLKLIWSRPDGHDNEQEYHVRLHEDEQWTVEDRGSARQATRADFMTV LSDLQHILILATPKVPTVSTSISNVILESSITTRAPGATHASDIELCQCPSGYTGTSC ESCAPLHYRDASGRCSQCPCDASNTESCGLVSGGNVECQCRPRWRGDRCREIDTSPII EEPPQICDLSRGFCCSGFQFDIAPNETISFNDTLQIYKGNRIIGNMTKLRYGCPSRET NEPTPEPDTSTDDPVRTQIIVSIARPEITILPVGGSLTLSCTGRMRWTNSPVFVNWYK QGSHLPEGVEVQGGNLQLFNLQISDSGIYICQAVSNETGHSFTDHVSITVSQEDQRSP AHIVDLPNDVTFEEYVSNEIVCEVEGNPPPTVTWTRVDGHADAQSTRTDNNRLVFDSP RKSDEGRYRCQAENSLSREEKYVVVYVRSNPPQPPPQQDRLYITPQEVNGVAGDSFQL SCQFTSAASLRYDWSHDGRSLSASSPRNVVVRGNVLEVRDANVRDSGTYTCVAFDLRT RRNFTESARVYIEQPNEPGILGDKPHILTLEQNIIIVQGEDLSITCEASGTPYPSIKW TKVQENLAENVRISGNVLTIYGGRSENRGLYSCIAENSHGSDQSSTSIDIEPRERPSL TIDTATQKVSVGSQASLYCAAQGIPEPTVEWVRTDGQPLSPRHKVQAPGYVVIDDIVL DDSGTYECRASNIAGQVSGLATINVQEPTLVRIEPDRQHHIVTQGDELSLSCVGSGVP TPSVFWSFEGRDVDRMGVPEGAVFAQPFRTNTADVKIFRVSKENEGIYVCHGSNDAGE DQQYIRVEVQPRRGDVGAGGDDNGDVDTRQPPNRPQIQPNPLSNERLTTELGNNVTLI CNVDNVNTEWERVDGTPLPHNAYTVRNTLVIVFVEPQNLGQYRCNGIGRDGRVEAHVV RELVLLPLPRITFYPNIPLTVELGQNLDVYCQVENVRPEDVHWTTDNNRPLPSSVRIE GNVLRFASITQAAAGEYRCSATNQYGSRSKNARVVVKQPSGFQPVPHSQVQQRQVGDS IQLRCRLTTQYGDEVRGNIQFNWYREDGSPLPRGVRPDSQVLQLVKLQPEDEGRYICN SYDLGSGQQLPPVSIDLQVLRTTTQYPFNRFKGGVSLKDTPCMVLYICAAVPAAPQNP IYLPPVAPPRSPERILEPQLSLSVQSSNLPAGDGTTVECFSSDDSYPDVVWERADGAP LSENVQQVGNNLVISNVASTDAGNYVCKCKTDEGDLYTTSYKLEVEEQPHELKSSKIV YAKVGGNADLQCGADEDRQPSYRWSRQYGQLQAGRSLQNEKLSLDRVQANDAGTYVCS AQYSDGETVDFPNILVVTGAIPQFRQEPRSYMSFPTLSNSSFKFNFELTFRPENADGL LLFNGQTRGSGDYIALSLKDRYAEFRFDFGGKPLLVRAEEPLALDEWHTVRVSRFKRD GYIQVDDQHPVAFPTSQHQQIPQLELIEDLYIGGVPNWEFLPAEAVGQQSGFVGCISR LTLQGRTVELIREAKFKEGITDCRPCAQGPCQNKGVCLESQTEQAYTCVCQPGWTGRD CAIEGTQCTAGVCGSGRCENTENDMECLCPLNRAGDRCQYNEILNEQSLNFKSNSFAA YGTPKVTKVNITLSVRPASLEDSVILYTAESTLPSGDYLALVLRGGHAELLINTAARL DPVVVRSAEPLPLNRWTRIEIRRRLGEGILKVGDGPERKAKAPGSDRILSLKTHLFVG GVDRSTVKINRDVNITKGFDGCISKLYNSQKSVNLLGDIRDAANVQNCGEANEIDDDE YEMPVALPSPKVAENERQLMAPCASDPCENGGSCSEQEDMAICSCPFGFSGKHCQNHL QLSFNASFRGDGYVELNRSHFQPALEQTYSHIGIVFTTNKPNGLLFWWGQEAGEEYTG QDFIAAAVVDGYVEYSMRLDGEEAVIRNSDIRVDNGERHIVIAKRDENTAMLELDQIL DTGDTRPTINKAMKLPGNVFVGGAPDVAAFTGFRYKDNFNGCIVVVEGETVGQINLSS AAINGVNANVCPANDEPLGGTEPPVV" misc_feature 300..398 /gene="trol" /note="Low-density lipoprotein receptor domain class A; Region: LDLa; smart00192" /db_xref="CDD:197566" misc_feature order(318..320,342..344,375..380) /gene="trol" /note="putative binding surface [active]" /db_xref="CDD:238060" misc_feature order(354..356,363..365,375..377,393..398) /gene="trol" /note="calcium-binding site [ion binding]; other site" /db_xref="CDD:238060" misc_feature 384..398 /gene="trol" /note="D-X-S-D-E motif; other site" /db_xref="CDD:238060" misc_feature 414..518 /gene="trol" /note="Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about...; Region: LDLa; cd00112" /db_xref="CDD:238060" misc_feature order(429..431,453..455,486..491) /gene="trol" /note="putative binding surface [active]" /db_xref="CDD:238060" misc_feature order(465..467,474..476,486..488,504..509) /gene="trol" /note="calcium-binding site [ion binding]; other site" /db_xref="CDD:238060" misc_feature 495..509 /gene="trol" /note="D-X-S-D-E motif; other site" /db_xref="CDD:238060" misc_feature 534..638 /gene="trol" /note="Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about...; Region: LDLa; cd00112" /db_xref="CDD:238060" misc_feature order(549..551,573..575,606..611) /gene="trol" /note="putative binding surface [active]" /db_xref="CDD:238060" misc_feature order(585..587,594..596,606..608,624..629) /gene="trol" /note="calcium-binding site [ion binding]; other site" /db_xref="CDD:238060" misc_feature 615..629 /gene="trol" /note="D-X-S-D-E motif; other site" /db_xref="CDD:238060" misc_feature 681..887 /gene="trol" /note="Immunoglobulin domain; Region: Ig_3; pfam13927" /db_xref="CDD:464046" misc_feature 981..1085 /gene="trol" /note="Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about...; Region: LDLa; cd00112" /db_xref="CDD:238060" misc_feature order(996..998,1020..1022,1053..1058) /gene="trol" /note="putative binding surface [active]" /db_xref="CDD:238060" misc_feature order(1032..1034,1041..1043,1053..1055,1071..1076) /gene="trol" /note="calcium-binding site [ion binding]; other site" /db_xref="CDD:238060" misc_feature 1062..1076 /gene="trol" /note="D-X-S-D-E motif; other site" /db_xref="CDD:238060" misc_feature 1101..1205 /gene="trol" /note="Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about...; Region: LDLa; cd00112" /db_xref="CDD:238060" misc_feature order(1116..1118,1140..1142,1173..1178) /gene="trol" /note="putative binding surface [active]" /db_xref="CDD:238060" misc_feature order(1152..1154,1161..1163,1173..1175,1191..1196) /gene="trol" /note="calcium-binding site [ion binding]; other site" /db_xref="CDD:238060" misc_feature 1182..1196 /gene="trol" /note="D-X-S-D-E motif; other site" /db_xref="CDD:238060" misc_feature 1230..1334 /gene="trol" /note="Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about...; Region: LDLa; cd00112" /db_xref="CDD:238060" misc_feature order(1245..1247,1269..1271,1302..1307) /gene="trol" /note="putative binding surface [active]" /db_xref="CDD:238060" misc_feature order(1281..1283,1290..1292,1302..1304,1320..1325) /gene="trol" /note="calcium-binding site [ion binding]; other site" /db_xref="CDD:238060" misc_feature 1311..1325 /gene="trol" /note="D-X-S-D-E motif; other site" /db_xref="CDD:238060" misc_feature 1386..1613 /gene="trol" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 1395..1409 /gene="trol" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 1434..1448 /gene="trol" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 1503..1517 /gene="trol" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 1545..1562 /gene="trol" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 1587..1598 /gene="trol" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 1908..2300 /gene="trol" /note="Laminin B (Domain IV); Region: Laminin_B; pfam00052" /db_xref="CDD:459652" misc_feature 2469..2630 /gene="trol" /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053" /db_xref="CDD:395007" misc_feature order(2469..2471,2475..2477,2511..2513,2541..2543, 2547..2549,2574..2576) /gene="trol" /note="EGF-like motif [active]" /db_xref="CDD:238012" misc_feature 2649..2783 /gene="trol" /note="Laminin-type epidermal growth factor-like domai; Region: EGF_Lam; smart00180" /db_xref="CDD:214543" misc_feature 3003..3413 /gene="trol" /note="Laminin B (Domain IV); Region: Laminin_B; pfam00052" /db_xref="CDD:459652" misc_feature <3414..3494 /gene="trol" /note="Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in...; Region: EGF_Lam; cd00055" /db_xref="CDD:238012" misc_feature 3516..3665 /gene="trol" /note="Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in...; Region: EGF_Lam; cd00055" /db_xref="CDD:238012" misc_feature order(3519..3521,3525..3527,3546..3548,3567..3569, 3576..3578,3603..3605) /gene="trol" /note="EGF-like motif [active]" /db_xref="CDD:238012" misc_feature <3774..3866 /gene="trol" /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053" /db_xref="CDD:395007" misc_feature 4062..4466 /gene="trol" /note="Laminin B (Domain IV); Region: Laminin_B; pfam00052" /db_xref="CDD:459652" misc_feature 4929..5177 /gene="trol" /note="Immunoglobulin like; Region: IG_like; smart00410" /db_xref="CDD:214653" misc_feature 4962..4976 /gene="trol" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 5010..5024 /gene="trol" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 5067..5081 /gene="trol" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 5109..5126 /gene="trol" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 5154..5165 /gene="trol" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature <5256..5417 /gene="trol" /note="Immunoglobulin domain; Region: Ig_3; pfam13927" /db_xref="CDD:464046" misc_feature 5508..5759 /gene="trol" /note="Immunoglobulin like; Region: IG_like; smart00410" /db_xref="CDD:214653" misc_feature 5541..5555 /gene="trol" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 5580..5594 /gene="trol" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 5649..5663 /gene="trol" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 5691..5708 /gene="trol" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 5796..6038 /gene="trol" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 5847..5861 /gene="trol" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409570" misc_feature 5886..5900 /gene="trol" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409570" misc_feature 5943..5957 /gene="trol" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409570" misc_feature 5985..6002 /gene="trol" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409570" misc_feature 6024..6035 /gene="trol" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409570" misc_feature 6090..6320 /gene="trol" /note="Immunoglobulin I-set domain; Region: I-set; pfam07679" /db_xref="CDD:400151" misc_feature 6114..6128 /gene="trol" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 6153..6167 /gene="trol" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 6258..6275 /gene="trol" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 6297..6308 /gene="trol" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 6357..6620 /gene="trol" /note="Immunoglobulin like; Region: IG_like; smart00410" /db_xref="CDD:214653" misc_feature 6387..6401 /gene="trol" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 6426..6440 /gene="trol" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 6558..6575 /gene="trol" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 6993..7223 /gene="trol" /note="Immunoglobulin like; Region: IG_like; smart00410" /db_xref="CDD:214653" misc_feature 7020..7034 /gene="trol" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 7059..7073 /gene="trol" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 7119..7133 /gene="trol" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 7161..7178 /gene="trol" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 7257..>7460 /gene="trol" /note="Immunoglobulin like; Region: IG_like; smart00410" /db_xref="CDD:214653" misc_feature 7290..7304 /gene="trol" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 7338..7361 /gene="trol" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 7407..7421 /gene="trol" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 7707..7913 /gene="trol" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 7779..7793 /gene="trol" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 7842..7853 /gene="trol" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 7881..7898 /gene="trol" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 7983..8183 /gene="trol" /note="Immunoglobulin like; Region: IG_like; smart00410" /db_xref="CDD:214653" misc_feature 8007..8021 /gene="trol" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 8046..8060 /gene="trol" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 8103..8117 /gene="trol" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 8145..8162 /gene="trol" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 8247..8690 /gene="trol" /note="Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans. Proteins that contain LamG domains serve a variety of...; Region: LamG; cd00110" /db_xref="CDD:238058" misc_feature 8757..8855 /gene="trol" /note="EGF-like domain; Region: EGF; pfam00008" /db_xref="CDD:394967" misc_feature 8997..9458 /gene="trol" /note="Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans. Proteins that contain LamG domains serve a variety of...; Region: LamG; cd00110" /db_xref="CDD:238058" misc_feature 9618..9716 /gene="trol" /note="Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the...; Region: EGF_CA; cd00054" /db_xref="CDD:238011" misc_feature 9741..10202 /gene="trol" /note="Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans. Proteins that contain LamG domains serve a variety of...; Region: LamG; cd00110" /db_xref="CDD:238058" polyA_site 11001 /gene="trol" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 agttcaacgt gaggcgtttg cgtgtgcgtt acgttggcgc gactttggtt ccagctcagt 61 agtagtacca agaacatcct tacttctcga ttagtgtctc ccgaatctca tcggaccagt 121 tgtaaaacaa gaaaagtttt ttcaccctag ctcgcgcttc cgcatccgca tccgcatacg 181 aatctctcgc atccgcgatg ggacggcgcc tgagggcagc tttttggctg ctggcggccc 241 tgatcgtcat tgaaaagccc cagaaaagca ttgcccgcgg cacttatgtc gcctacggtg 301 aatgccgggc caccgagttc agatgcaaca atggggactg catcgatatt agaaagcgtt 361 gcgatcacat ttcggactgt agcgaaggcg aggacgagaa cgaggagtgc cgctgttacg 421 cggatcaatt ccgctgcaat aatggtgact gcattgcgga atcggctcat tgcgatggaa 481 atatcgattg tagcgaccag tccgatgaac tcgactgcgg aggagactcg cagtgtctgc 541 ccaaccaatt ccgctgcaag aatggccaat gtgtgagctc tacagcgcgt tgcaacaagc 601 gttccgattg tttggatggc tccgatgagc agaattgtgc caatgaacct aacaactccg 661 gacgtggaac gaaccaattg aaactcaaga cctatcccga caaccaaatc attaaggaga 721 gtcgtgaggt catcttccgt tgccgtgacg aaggtcccaa ccgcgccaag gtcaagtggt 781 cgcgacccgg cggacgtccc ctgccccccg gtttcaccga tcgcaatggc cgcctggaga 841 tccccaacat cagggtggag gatgctggcg cctatgtctg cgaggccgtg ggctatgcca 901 actatattcc cggtcagcac gtcaccgtaa acctcaacgt cgagcgctta aacgaacgcg 961 aaatccgtcc ggactcagcc tgtacggagt accaggccac ctgcatgaac ggcgagtgta 1021 tcgataagtc gggcatctgc gatggacatc cggactgttc ggatggctcc gatgagcaca 1081 gctgcagttt gggtttgaag tgtcagccca accagttcat gtgctccaat tccaagtgtg 1141 tggatcgcac ctggcgctgt gatggcgaga acgactgcgg cgataactcc gatgagacct 1201 cttgcgatcc ggaaccaagt gatgctccgt gccgatacga cgaattccag tgccgcagcg 1261 gtcattgcat tcccaagagc ttccagtgcg actatatgaa cgattgtacc gatggtaccg 1321 atgaaattgg atgctcggtg ccctctccaa tgaccctacc cgcaccctcg attgtcgtga 1381 tggagtacga ggtcctcgag ctgacctgcg tgggcaccgg cgtcccgacg ccgacgatcg 1441 tgtggcgtct caactggggc catgtgcccg agaagtgtga atcgaagagc tacggcggaa 1501 ccggaaccct gcgctgtccg aacatgaggc cccaggacag tggtgcctac tcgtgcgagt 1561 tcatcaacac acgcggcacc ttctatccga aaacgaactc gattgtcacc gttacgccgg 1621 tgcgctcgga tgtctgcaag gccggattct tcaatatgct ggcccgcaag tcggaggaat 1681 gcgtccagtg cttctgcttt ggcgtttcga ccaactgtga cagtgccaat ttgttcacct 1741 acgccattca gccaccgatc ctttcgcacc gcgtggtcag cgttgaactc agtccgttcc 1801 gtcaaattgt catcaatgag gctagtccgg gtcaggatct gctcaccttg caccatggtg 1861 ttcagttcag ggcatcgaac gtacactaca acggccggga gacaccattc ttggccctgc 1921 ccgctgagta tatgggcaac cagctgaagt cctatggcgg caatctgcgc tacgaggtca 1981 ggtacaatgg caacggtaga ccggtcagcg gacccgatgt catcatcacc ggcaacagtt 2041 tcacgctaac ccatcgcgtt cgcactcatc cgggtcagaa caacagggtg actattccct 2101 tcctgccggg aggctggacg aagccggatg gtcgcaaggg aacgcgagag gacatcatga 2161 tgatactggc caatgtggac aatattctga ttcgactggg ctacctggat agcacagctc 2221 gcgaagtgga tctgataaat atcgccttgg attcggccgg aagtgccgat cagggattgg 2281 gcagtgcctc gctcgtggag aagtgcacct gtccgcccgg ctatgttggt gattcgtgcg 2341 agtcctgtgc ctcgggctat gttcgccagg cccgcggacc ttggctgggt cattgtgtgc 2401 ccttcacccc ggaaccgtgc ccagcgggaa cctacggcaa tccccgactt ggtgttccct 2461 gccaggagtg tccgtgcccc cacgcgggcg ccaataactt tgccagcggc tgccaacaga 2521 gtcccgatgg cgatgtgatt tgccgctgca acgaaggcta tgccggcaag aggtgcgagc 2581 actgcgccca gggttaccag ggtaatccgt tggcaccggg aggagtctgt cgcaagatac 2641 ccgatagttc gtgcaatgtc gacggcacct acaacatcta cagcaatgga acgtgccagt 2701 gcaaggatag cgtgattggc gaacagtgcg acacctgcgc gccgaagagt ttccacctca 2761 attcgttcac ctacaccggt tgcatcgagt gcttctgcag tggagtgggc ttggattgtg 2821 acagtagttc gtggtatcgc aaccaggtca ccagcacctt tggacgaacg cgcgtcaatc 2881 atggattcgc cctgattagc gactatatgc gcaatacccc ggtaacggtg cccgtttcca 2941 tgtccaccca ggccaatgcc ttgagcttcg tgggatccgc cgagcaggcc ggtaatacgc 3001 tctactggag tcttcccgcc gccttcctgg gcaacaagct gacctcgtac ggaggcaagt 3061 tgagctacac gctcagctac agtcccctgc ccagcggcat tatgtcgcgc aacagtgccc 3121 ccgatgtggt gatcaagagc ggcgaggatc tgaggctcat ccattacagg aagtcgcagg 3181 tcagtcccag tgtggccaac acctatgccg tggagatcaa ggagagcgca tggcagcgcg 3241 gcgatgaact ggtgcctaac cgtgaacacg tcctgatggc cctcagcaat attacggcca 3301 tctatatcaa ggccacgtac acgactagca ccaaggaggc ctcgctgcga tcggtcacat 3361 tggatacggc cacggccacc aatctgggca ccgcacgtgc cgtcgaagtg gagcagtgcc 3421 gctgtcccga gggctatttg ggtctctcct gcgagcagtg tgctcctggc tatacgcgcg 3481 atccggaggc aggaatctat ctgggtctct gcaggccctg cgagtgcaat ggacattcca 3541 agtattgcaa cagtgagaca ggcgaatgcg aaagctgttc cgacaacacc gaaggattca 3601 attgtgaccg atgcgccgcc ggctatgtgg gtgatgccac ccgaggaact tcgtacgact 3661 gtcaatacga tgacggcggc tatccgacgt cgcgtccacc ggcaccgggc aatcagacgg 3721 ccgaatgcct ggtgaattgc caacaggagg gaaccgccgg ttgccgcggc taccagtgcg 3781 agtgcaagag gaatgtggct ggcgatcgat gcgatcagtg ccgccccgga acctatggac 3841 tgtcggccca aaatccggac ggttgcaagg agtgctactg ctccggactg accaaccagt 3901 gccgctcggc gtctctctac cgccagctga tacccgtgga cttcatttcg acgccaccat 3961 tgataacaga cgaattcggc gacatcatgg atagggataa ccttgtgccc gacgtgccca 4021 ggaatgtgta tacctacaag cacacctcct acacgcccaa gtactggagc ctgaggggta 4081 gtgtgctggg caaccagctg ttgtcgtacg gcggccgctt ggagtacagc ctgattgtgg 4141 agtccgttgg ccgggaccat cgtggcaagg atgtggtcct aattggcaac ggactcaagc 4201 tgatctggtc gcgacccgat ggccatgaca acgagcagga ataccatgtg cgtttgcatg 4261 aggacgagca gtggacggtt gaggatcgtg gatcggcacg acaggccacg cgggccgact 4321 tcatgactgt gctgtcggat ctgcagcaca tcctgatcct ggccacaccc aaggtgccca 4381 cggtcagcac ctcgattagc aatgtcatcc tggagagttc gataaccacg agagcgcctg 4441 gagctacgca tgcctccgat atcgagttgt gccagtgtcc atccggttat acgggcactt 4501 cctgtgagtc ctgcgcacca ctgcactacc gcgacgcctc tggacgctgc agtcagtgtc 4561 cttgcgacgc ttccaacacg gaatcctgcg gcttggtcag cggcggtaac gtcgaatgcc 4621 agtgcaggcc acgctggagg ggtgatcgct gccgggaaat tgacacatcg cccattatcg 4681 aagaaccgcc ccagatatgt gatttaagca ggggattctg ttgcagcggc tttcagttcg 4741 atatcgcacc gaacgagaca atctcgttta atgacaccct gcagatatat aagggcaaca 4801 gaatcatagg aaatatgacc aagctgcgct acggctgtcc atcgcgagaa actaacgaac 4861 cgactccgga accggatacc agtaccgatg atcccgtgcg cacccagatc atagtgtcga 4921 ttgccaggcc agagattacc attctgcccg tgggtggatc gctgaccctc agctgtaccg 4981 gtcgaatgcg ctggaccaat agcccagtgt ttgtgaactg gtacaagcag ggcagtcacc 5041 tgcccgaggg agtcgaggtg caaggcggta atctgcagct gttcaacctg cagatcagcg 5101 attctggaat ctacatctgc caggccgtaa gcaacgagac cggccacagc tttacggacc 5161 acgtctccat caccgtttcc caggaggacc aacgctcgcc ggctcacatt gtggatttgc 5221 ccaacgacgt gaccttcgag gagtacgtaa gcaatgagat cgtctgcgag gtggagggca 5281 acccaccacc cactgtcacc tggactcgcg tggatggcca tgcggacgcc caaagtacgc 5341 gaacggacaa caatcggctg gtcttcgatt cgccgaggaa atcggacgag ggtcgctatc 5401 gctgccaggc agagaatagc ctgagtcggg aggagaagta cgtagtcgtg tatgtccgga 5461 gcaatcctcc ccagccgccg ccgcagcagg atcgtttgta catcacaccg caggaggtga 5521 acggtgtggc cggtgactcc ttccagttgt cctgccaatt caccagcgct gcctctctgc 5581 gctacgattg gtcccacgat ggtcgctccc tgtccgcgtc gtcaccccga aatgttgtgg 5641 tccgcggaaa tgtcctggaa gtccgcgatg ccaacgttcg cgactccggc acctacacct 5701 gtgtggcctt cgacctgcgc acccgacgca acttcaccga gagcgcacgg gtctacatcg 5761 agcagcccaa cgagccggga atccttggcg acaagccgca tatcttgacc ttggagcaga 5821 acatcataat tgtgcaaggc gaggacttga gcatcacatg tgaggcaagt ggaacgccct 5881 atccctcgat taagtggacc aaggtgcagg agaatctggc cgaaaatgtc cgcatcagtg 5941 gcaatgtgct caccatctac ggaggccgca gtgagaatcg tggtctttac tcctgcatcg 6001 ccgagaactc tcacggcagc gatcagtcca gcacaagcat cgatattgaa ccccgggagc 6061 ggccgagtct tacgattgat acggccaccc aaaaggtttc ggttggctcc caggcgtccc 6121 tttactgtgc cgcccagggc attcccgaac cgaccgtcga gtgggttcga acggatggtc 6181 agccactgtc gccgcgtcac aaggtccagg cacccggcta tgttgtgatc gatgacattg 6241 tgctcgatga tagcggtacc tacgagtgcc gggcgagcaa catagctggc caggtgagcg 6301 gcttggccac cattaacgtc caggagccaa ctcttgtgcg gatcgaacca gataggcaac 6361 accatatcgt cacccagggc gacgaactct cgctcagctg cgtgggcagt ggcgtcccta 6421 ctccttcggt cttttggagt ttcgagggaa gagacgttga caggatggga gtaccggaag 6481 gtgctgtttt tgcgcaacct ttccgaacca acactgccga cgtgaaaatc ttccgggtga 6541 gcaaggagaa cgaaggcatc tacgtctgtc acggatccaa tgacgcgggt gaagatcaac 6601 aatacattcg cgtggaggta caacccagac ggggtgacgt cggtgcagga ggagatgaca 6661 atggtgatgt cgatacccga cagcccccca atcggcccca aatccaaccg aatccattga 6721 gcaacgaacg cctgaccacc gaattgggca acaatgtgac cctcatctgc aacgtggaca 6781 acgtgaacac ggaatgggaa cgcgtcgatg gcacacccct gccgcacaat gcctacacgg 6841 tgagaaatac gctggtgatt gtcttcgtgg agccgcagaa tctgggtcag taccgctgca 6901 atggaatcgg tcgcgatgga cgtgtggagg cccatgtggt gagggagctg gttctcctgc 6961 ccctgcccag gatcaccttc tatcccaaca tcccgctgac cgtggagctg ggccagaact 7021 tggatgtcta ctgccaggtg gagaacgtgc gtccggagga cgtgcattgg accaccgaca 7081 acaatcgacc actgcccagt tccgtacgca tcgagggcaa tgtcctcagg ttcgcgtcca 7141 tcactcaggc tgctgccggt gaataccgct gctcggccac caatcaatat ggaagccgat 7201 cgaagaacgc cagggtggtg gtgaaacagc ccagtggctt ccagcccgtt ccccactcgc 7261 aggtgcaaca gcgtcaggtg ggcgactcca tccagttgcg atgccgcctg accacccagt 7321 acggcgacga ggttcgcggc aatatccagt tcaactggta ccgtgaggac ggcagcccct 7381 tgccccgcgg tgtccgtccg gatagccagg tgctgcagct ggttaaattg cagcccgagg 7441 acgagggccg ctacatctgc aactcgtacg atttgggcag cgggcagcaa ctgccccccg 7501 tctccatcga cttgcaagta ctaagaacta ctacccagta tcctttcaat cggtttaagg 7561 gcggtgtctc cctgaaagac acgccctgca tggttctgta tatttgtgca gcggtaccag 7621 cggctcccca gaaccccatc tacctgccgc cagtggcgcc accacgttcg cccgaaagga 7681 tcctcgagcc ccaactgagc ctgagtgtac aatcctcgaa cctgccagcc ggcgacggca 7741 ccaccgtcga gtgcttctcc tccgatgact cctacccaga tgtcgtgtgg gaacgcgccg 7801 atggagctcc actcagcgaa aatgtccagc aagtgggcaa taacctggtg attagtaacg 7861 tggcctccac cgatgccggt aactatgtgt gcaagtgcaa gacggacgag ggagatctgt 7921 ataccaccag ctacaaactg gaggtcgagg agcagcccca tgaactgaag agctccaaga 7981 tagtctacgc caaggttggc ggaaatgccg acttgcagtg cggagccgat gaagatcgac 8041 agcccagcta ccgttggtct cgccaatacg gacaacttca ggcgggacgc agtctgcaga 8101 atgagaaact ttcgttggat cgcgttcagg ccaacgatgc cggaacttat gtttgttcgg 8161 cccaatacag cgatggcgag acggttgact tccccaacat tctggttgtg accggggcga 8221 ttccccagtt ccgccaggag ccccgcagct acatgagctt ccccacgctc tcgaactcct 8281 cgttcaagtt caacttcgag ctgaccttcc ggccggaaaa cgccgacgga ctgctgctct 8341 tcaatggaca gacccgcgga agcggtgact atatcgcact ctcgctgaag gatcgctatg 8401 cggagttccg gttcgatttt ggcggtaaac cgttgctggt gcgagcggag gagccactgg 8461 ctttggatga atggcacacg gtgcgcgtga gtcgcttcaa gcgggatggc tacatccagg 8521 tggacgacca gcatccggtg gccttcccca cctcccagca tcagcagata ccccagttgg 8581 aactgattga ggatctgtac attggcggcg tgcccaactg ggagttcctg cccgccgagg 8641 cggtgggtca gcaatcaggc ttcgtgggct gcattagccg gctgaccctg cagggacgca 8701 ccgtggagct gatccgggag gccaagttca aggagggcat caccgattgc cggccctgcg 8761 cccagggacc ctgccagaac aagggcgtct gcctggagag ccagacggag caggcctaca 8821 cctgcgtctg ccagccgggc tggactggcc gggattgtgc catcgagggc acccagtgca 8881 ccgcaggagt ttgcggctcg ggacgctgcg agaatacgga gaacgacatg gagtgcctgt 8941 gcccgctgaa cagggcaggc gatcgatgcc agtacaatga gattctaaat gaacagagct 9001 tgaatttcaa gagcaacagc tttgcggcct acggaactcc caaggtcacc aaagtaaaca 9061 tcacactctc cgttcgtccc gcgagcctgg aggactctgt gatcctgtac acggcggaat 9121 ccactctgcc cagcggcgat tacctggctt tggtccttcg cggtggccac gcggagctgc 9181 tgatcaacac ggccgcccgc ttggatcccg tggtggtgcg ttcggcggaa ccgctgcccc 9241 tcaatcgctg gaccagaatc gagatcaggc gtcgcctggg cgagggaatc ctcaaggtgg 9301 gcgatggacc cgagcgaaag gccaaggcac cgggatccga tcgcattctg tcgctcaaga 9361 cccacctctt tgtgggcggc gtcgatcggt cgaccgtaaa gatcaaccgt gatgtgaaca 9421 tcaccaaggg cttcgatggc tgcatctcga agctgtacaa ctcgcagaaa tccgtcaatc 9481 tgctgggtga catcagggat gcggcgaatg tccagaactg tggggaggcg aatgagatag 9541 atgacgatga gtatgagatg ccagtagcgc tgccatcgcc taaggtcgcc gagaatgaac 9601 gtcagctgat ggcgccgtgt gccagtgatc cctgcgagaa cgggggaagc tgcagcgagc 9661 aggaggacat ggccatctgc tcctgtccct tcggcttcag cggcaaacac tgccagaatc 9721 acctccagct gagcttcaat gcctcgttcc gcggcgatgg ctacgtggag ctgaaccgca 9781 gccacttcca acccgccctg gagcagacgt actcccacat tggcattgtg ttcaccacca 9841 acaagccgaa tggcctgctt ttctggtggg gccaggaggc cggggaggag tacaccggac 9901 aggacttcat tgccgccgcc gtggtcgatg gctatgtgga gtactcgatg aggctcgatg 9961 gcgaggaggc ggtcattcgg aacagcgata tccgcgtgga caatggcgag cggcacattg 10021 tgatcgccaa gcgggatgag aacaccgcca tgctggaact cgatcagatc ctggacacgg 10081 gcgatacgcg acccaccatc aacaaggcaa tgaagctgcc gggcaatgtg tttgtcggtg 10141 gcgctcctga tgtcgcggca ttcacgggct tccgctacaa ggacaatttc aacggctgca 10201 ttgtggtcgt cgagggcgaa accgtgggcc aaattaacct tagttcagct gccatcaatg 10261 gagtgaatgc caacgtgtgt cccgctaacg acgaacctct gggaggaacc gaaccgccag 10321 tcgtctgagg acacaaccag caaccgaaat tagcttttta attaaacatt aacaaatgaa 10381 acaaaaagaa aaacaatttt tatatataca acatatgaat aagccccaag caaacctaca 10441 aaaaattgaa tattatacga cgaacagata atataaaaac aaaaaaagag agaaacgatc 10501 acttctacta caattgcttc ttcgatcctt aagtctaggt taaagattgt agcaagaaaa 10561 caagcgaata tcacaaacat ttatttaaca agaacgccat gcgagaagtg aaacgaaaca 10621 gaaacaataa tgcaattaat gcagataata cagataaagc ctagaaccct aagaactaac 10681 taactaactc gaacaagaac aacaacgcat actagccaac tgcaaccaca acaaccacaa 10741 tagtgaaggc attttaatta taattttagt ctctagctta taactatgac tacgactcgt 10801 tttttttgtg agcccagtgt aaaatgttgg aaatcggaaa ttggccctac acacaaacac 10861 acacaagtta ttaattaaat accaattgat accatataat gataaatgaa atactatgaa 10921 tgcaactatt gtgaacgaac gaaaaccgtt gagtggataa aaagcataag cagaagatat 10981 attaaaatga aatcaacaac a