Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii terribly reduced optic lobes


LOCUS       XM_070218442           11001 bp    mRNA    linear   INV 09-DEC-2024
            (trol), transcript variant X30, mRNA.
ACCESSION   XM_070218442
VERSION     XM_070218442.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..11001
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..11001
                     /gene="trol"
                     /note="terribly reduced optic lobes; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 7
                     Proteins"
                     /db_xref="GeneID:108055788"
     CDS             198..10328
                     /gene="trol"
                     /codon_start=1
                     /product="basement membrane-specific heparan sulfate
                     proteoglycan core protein isoform X30"
                     /protein_id="XP_070074543.1"
                     /db_xref="GeneID:108055788"
                     /translation="MGRRLRAAFWLLAALIVIEKPQKSIARGTYVAYGECRATEFRCN
                     NGDCIDIRKRCDHISDCSEGEDENEECRCYADQFRCNNGDCIAESAHCDGNIDCSDQS
                     DELDCGGDSQCLPNQFRCKNGQCVSSTARCNKRSDCLDGSDEQNCANEPNNSGRGTNQ
                     LKLKTYPDNQIIKESREVIFRCRDEGPNRAKVKWSRPGGRPLPPGFTDRNGRLEIPNI
                     RVEDAGAYVCEAVGYANYIPGQHVTVNLNVERLNEREIRPDSACTEYQATCMNGECID
                     KSGICDGHPDCSDGSDEHSCSLGLKCQPNQFMCSNSKCVDRTWRCDGENDCGDNSDET
                     SCDPEPSDAPCRYDEFQCRSGHCIPKSFQCDYMNDCTDGTDEIGCSVPSPMTLPAPSI
                     VVMEYEVLELTCVGTGVPTPTIVWRLNWGHVPEKCESKSYGGTGTLRCPNMRPQDSGA
                     YSCEFINTRGTFYPKTNSIVTVTPVRSDVCKAGFFNMLARKSEECVQCFCFGVSTNCD
                     SANLFTYAIQPPILSHRVVSVELSPFRQIVINEASPGQDLLTLHHGVQFRASNVHYNG
                     RETPFLALPAEYMGNQLKSYGGNLRYEVRYNGNGRPVSGPDVIITGNSFTLTHRVRTH
                     PGQNNRVTIPFLPGGWTKPDGRKGTREDIMMILANVDNILIRLGYLDSTAREVDLINI
                     ALDSAGSADQGLGSASLVEKCTCPPGYVGDSCESCASGYVRQARGPWLGHCVPFTPEP
                     CPAGTYGNPRLGVPCQECPCPHAGANNFASGCQQSPDGDVICRCNEGYAGKRCEHCAQ
                     GYQGNPLAPGGVCRKIPDSSCNVDGTYNIYSNGTCQCKDSVIGEQCDTCAPKSFHLNS
                     FTYTGCIECFCSGVGLDCDSSSWYRNQVTSTFGRTRVNHGFALISDYMRNTPVTVPVS
                     MSTQANALSFVGSAEQAGNTLYWSLPAAFLGNKLTSYGGKLSYTLSYSPLPSGIMSRN
                     SAPDVVIKSGEDLRLIHYRKSQVSPSVANTYAVEIKESAWQRGDELVPNREHVLMALS
                     NITAIYIKATYTTSTKEASLRSVTLDTATATNLGTARAVEVEQCRCPEGYLGLSCEQC
                     APGYTRDPEAGIYLGLCRPCECNGHSKYCNSETGECESCSDNTEGFNCDRCAAGYVGD
                     ATRGTSYDCQYDDGGYPTSRPPAPGNQTAECLVNCQQEGTAGCRGYQCECKRNVAGDR
                     CDQCRPGTYGLSAQNPDGCKECYCSGLTNQCRSASLYRQLIPVDFISTPPLITDEFGD
                     IMDRDNLVPDVPRNVYTYKHTSYTPKYWSLRGSVLGNQLLSYGGRLEYSLIVESVGRD
                     HRGKDVVLIGNGLKLIWSRPDGHDNEQEYHVRLHEDEQWTVEDRGSARQATRADFMTV
                     LSDLQHILILATPKVPTVSTSISNVILESSITTRAPGATHASDIELCQCPSGYTGTSC
                     ESCAPLHYRDASGRCSQCPCDASNTESCGLVSGGNVECQCRPRWRGDRCREIDTSPII
                     EEPPQICDLSRGFCCSGFQFDIAPNETISFNDTLQIYKGNRIIGNMTKLRYGCPSRET
                     NEPTPEPDTSTDDPVRTQIIVSIARPEITILPVGGSLTLSCTGRMRWTNSPVFVNWYK
                     QGSHLPEGVEVQGGNLQLFNLQISDSGIYICQAVSNETGHSFTDHVSITVSQEDQRSP
                     AHIVDLPNDVTFEEYVSNEIVCEVEGNPPPTVTWTRVDGHADAQSTRTDNNRLVFDSP
                     RKSDEGRYRCQAENSLSREEKYVVVYVRSNPPQPPPQQDRLYITPQEVNGVAGDSFQL
                     SCQFTSAASLRYDWSHDGRSLSASSPRNVVVRGNVLEVRDANVRDSGTYTCVAFDLRT
                     RRNFTESARVYIEQPNEPGILGDKPHILTLEQNIIIVQGEDLSITCEASGTPYPSIKW
                     TKVQENLAENVRISGNVLTIYGGRSENRGLYSCIAENSHGSDQSSTSIDIEPRERPSL
                     TIDTATQKVSVGSQASLYCAAQGIPEPTVEWVRTDGQPLSPRHKVQAPGYVVIDDIVL
                     DDSGTYECRASNIAGQVSGLATINVQEPTLVRIEPDRQHHIVTQGDELSLSCVGSGVP
                     TPSVFWSFEGRDVDRMGVPEGAVFAQPFRTNTADVKIFRVSKENEGIYVCHGSNDAGE
                     DQQYIRVEVQPRRGDVGAGGDDNGDVDTRQPPNRPQIQPNPLSNERLTTELGNNVTLI
                     CNVDNVNTEWERVDGTPLPHNAYTVRNTLVIVFVEPQNLGQYRCNGIGRDGRVEAHVV
                     RELVLLPLPRITFYPNIPLTVELGQNLDVYCQVENVRPEDVHWTTDNNRPLPSSVRIE
                     GNVLRFASITQAAAGEYRCSATNQYGSRSKNARVVVKQPSGFQPVPHSQVQQRQVGDS
                     IQLRCRLTTQYGDEVRGNIQFNWYREDGSPLPRGVRPDSQVLQLVKLQPEDEGRYICN
                     SYDLGSGQQLPPVSIDLQVLRTTTQYPFNRFKGGVSLKDTPCMVLYICAAVPAAPQNP
                     IYLPPVAPPRSPERILEPQLSLSVQSSNLPAGDGTTVECFSSDDSYPDVVWERADGAP
                     LSENVQQVGNNLVISNVASTDAGNYVCKCKTDEGDLYTTSYKLEVEEQPHELKSSKIV
                     YAKVGGNADLQCGADEDRQPSYRWSRQYGQLQAGRSLQNEKLSLDRVQANDAGTYVCS
                     AQYSDGETVDFPNILVVTGAIPQFRQEPRSYMSFPTLSNSSFKFNFELTFRPENADGL
                     LLFNGQTRGSGDYIALSLKDRYAEFRFDFGGKPLLVRAEEPLALDEWHTVRVSRFKRD
                     GYIQVDDQHPVAFPTSQHQQIPQLELIEDLYIGGVPNWEFLPAEAVGQQSGFVGCISR
                     LTLQGRTVELIREAKFKEGITDCRPCAQGPCQNKGVCLESQTEQAYTCVCQPGWTGRD
                     CAIEGTQCTAGVCGSGRCENTENDMECLCPLNRAGDRCQYNEILNEQSLNFKSNSFAA
                     YGTPKVTKVNITLSVRPASLEDSVILYTAESTLPSGDYLALVLRGGHAELLINTAARL
                     DPVVVRSAEPLPLNRWTRIEIRRRLGEGILKVGDGPERKAKAPGSDRILSLKTHLFVG
                     GVDRSTVKINRDVNITKGFDGCISKLYNSQKSVNLLGDIRDAANVQNCGEANEIDDDE
                     YEMPVALPSPKVAENERQLMAPCASDPCENGGSCSEQEDMAICSCPFGFSGKHCQNHL
                     QLSFNASFRGDGYVELNRSHFQPALEQTYSHIGIVFTTNKPNGLLFWWGQEAGEEYTG
                     QDFIAAAVVDGYVEYSMRLDGEEAVIRNSDIRVDNGERHIVIAKRDENTAMLELDQIL
                     DTGDTRPTINKAMKLPGNVFVGGAPDVAAFTGFRYKDNFNGCIVVVEGETVGQINLSS
                     AAINGVNANVCPANDEPLGGTEPPVV"
     misc_feature    300..398
                     /gene="trol"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(318..320,342..344,375..380)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(354..356,363..365,375..377,393..398)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    384..398
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    414..518
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(429..431,453..455,486..491)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(465..467,474..476,486..488,504..509)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    495..509
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    534..638
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(549..551,573..575,606..611)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(585..587,594..596,606..608,624..629)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    615..629
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    681..887
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    981..1085
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(996..998,1020..1022,1053..1058)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1032..1034,1041..1043,1053..1055,1071..1076)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1062..1076
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1101..1205
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1116..1118,1140..1142,1173..1178)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1152..1154,1161..1163,1173..1175,1191..1196)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1182..1196
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1230..1334
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1245..1247,1269..1271,1302..1307)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1281..1283,1290..1292,1302..1304,1320..1325)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1311..1325
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1386..1613
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    1395..1409
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    1434..1448
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    1503..1517
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    1545..1562
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    1587..1598
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    1908..2300
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    2469..2630
                     /gene="trol"
                     /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053"
                     /db_xref="CDD:395007"
     misc_feature    order(2469..2471,2475..2477,2511..2513,2541..2543,
                     2547..2549,2574..2576)
                     /gene="trol"
                     /note="EGF-like motif [active]"
                     /db_xref="CDD:238012"
     misc_feature    2649..2783
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domai;
                     Region: EGF_Lam; smart00180"
                     /db_xref="CDD:214543"
     misc_feature    3003..3413
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    <3414..3494
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domain;
                     laminins are the major noncollagenous components of
                     basement membranes that mediate cell adhesion, growth
                     migration, and differentiation; the laminin-type epidermal
                     growth factor-like module occurs in...; Region: EGF_Lam;
                     cd00055"
                     /db_xref="CDD:238012"
     misc_feature    3516..3665
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domain;
                     laminins are the major noncollagenous components of
                     basement membranes that mediate cell adhesion, growth
                     migration, and differentiation; the laminin-type epidermal
                     growth factor-like module occurs in...; Region: EGF_Lam;
                     cd00055"
                     /db_xref="CDD:238012"
     misc_feature    order(3519..3521,3525..3527,3546..3548,3567..3569,
                     3576..3578,3603..3605)
                     /gene="trol"
                     /note="EGF-like motif [active]"
                     /db_xref="CDD:238012"
     misc_feature    <3774..3866
                     /gene="trol"
                     /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053"
                     /db_xref="CDD:395007"
     misc_feature    4062..4466
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    4929..5177
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    4962..4976
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    5010..5024
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    5067..5081
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    5109..5126
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    5154..5165
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    <5256..5417
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    5508..5759
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    5541..5555
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    5580..5594
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    5649..5663
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    5691..5708
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    5796..6038
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    5847..5861
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409570"
     misc_feature    5886..5900
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409570"
     misc_feature    5943..5957
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409570"
     misc_feature    5985..6002
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409570"
     misc_feature    6024..6035
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409570"
     misc_feature    6090..6320
                     /gene="trol"
                     /note="Immunoglobulin I-set domain; Region: I-set;
                     pfam07679"
                     /db_xref="CDD:400151"
     misc_feature    6114..6128
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    6153..6167
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    6258..6275
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    6297..6308
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    6357..6620
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    6387..6401
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    6426..6440
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    6558..6575
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    6993..7223
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    7020..7034
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    7059..7073
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    7119..7133
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    7161..7178
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    7257..>7460
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    7290..7304
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    7338..7361
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    7407..7421
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    7707..7913
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    7779..7793
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    7842..7853
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    7881..7898
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    7983..8183
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    8007..8021
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    8046..8060
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    8103..8117
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    8145..8162
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    8247..8690
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     misc_feature    8757..8855
                     /gene="trol"
                     /note="EGF-like domain; Region: EGF; pfam00008"
                     /db_xref="CDD:394967"
     misc_feature    8997..9458
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     misc_feature    9618..9716
                     /gene="trol"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    9741..10202
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     polyA_site      11001
                     /gene="trol"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 agttcaacgt gaggcgtttg cgtgtgcgtt acgttggcgc gactttggtt ccagctcagt
       61 agtagtacca agaacatcct tacttctcga ttagtgtctc ccgaatctca tcggaccagt
      121 tgtaaaacaa gaaaagtttt ttcaccctag ctcgcgcttc cgcatccgca tccgcatacg
      181 aatctctcgc atccgcgatg ggacggcgcc tgagggcagc tttttggctg ctggcggccc
      241 tgatcgtcat tgaaaagccc cagaaaagca ttgcccgcgg cacttatgtc gcctacggtg
      301 aatgccgggc caccgagttc agatgcaaca atggggactg catcgatatt agaaagcgtt
      361 gcgatcacat ttcggactgt agcgaaggcg aggacgagaa cgaggagtgc cgctgttacg
      421 cggatcaatt ccgctgcaat aatggtgact gcattgcgga atcggctcat tgcgatggaa
      481 atatcgattg tagcgaccag tccgatgaac tcgactgcgg aggagactcg cagtgtctgc
      541 ccaaccaatt ccgctgcaag aatggccaat gtgtgagctc tacagcgcgt tgcaacaagc
      601 gttccgattg tttggatggc tccgatgagc agaattgtgc caatgaacct aacaactccg
      661 gacgtggaac gaaccaattg aaactcaaga cctatcccga caaccaaatc attaaggaga
      721 gtcgtgaggt catcttccgt tgccgtgacg aaggtcccaa ccgcgccaag gtcaagtggt
      781 cgcgacccgg cggacgtccc ctgccccccg gtttcaccga tcgcaatggc cgcctggaga
      841 tccccaacat cagggtggag gatgctggcg cctatgtctg cgaggccgtg ggctatgcca
      901 actatattcc cggtcagcac gtcaccgtaa acctcaacgt cgagcgctta aacgaacgcg
      961 aaatccgtcc ggactcagcc tgtacggagt accaggccac ctgcatgaac ggcgagtgta
     1021 tcgataagtc gggcatctgc gatggacatc cggactgttc ggatggctcc gatgagcaca
     1081 gctgcagttt gggtttgaag tgtcagccca accagttcat gtgctccaat tccaagtgtg
     1141 tggatcgcac ctggcgctgt gatggcgaga acgactgcgg cgataactcc gatgagacct
     1201 cttgcgatcc ggaaccaagt gatgctccgt gccgatacga cgaattccag tgccgcagcg
     1261 gtcattgcat tcccaagagc ttccagtgcg actatatgaa cgattgtacc gatggtaccg
     1321 atgaaattgg atgctcggtg ccctctccaa tgaccctacc cgcaccctcg attgtcgtga
     1381 tggagtacga ggtcctcgag ctgacctgcg tgggcaccgg cgtcccgacg ccgacgatcg
     1441 tgtggcgtct caactggggc catgtgcccg agaagtgtga atcgaagagc tacggcggaa
     1501 ccggaaccct gcgctgtccg aacatgaggc cccaggacag tggtgcctac tcgtgcgagt
     1561 tcatcaacac acgcggcacc ttctatccga aaacgaactc gattgtcacc gttacgccgg
     1621 tgcgctcgga tgtctgcaag gccggattct tcaatatgct ggcccgcaag tcggaggaat
     1681 gcgtccagtg cttctgcttt ggcgtttcga ccaactgtga cagtgccaat ttgttcacct
     1741 acgccattca gccaccgatc ctttcgcacc gcgtggtcag cgttgaactc agtccgttcc
     1801 gtcaaattgt catcaatgag gctagtccgg gtcaggatct gctcaccttg caccatggtg
     1861 ttcagttcag ggcatcgaac gtacactaca acggccggga gacaccattc ttggccctgc
     1921 ccgctgagta tatgggcaac cagctgaagt cctatggcgg caatctgcgc tacgaggtca
     1981 ggtacaatgg caacggtaga ccggtcagcg gacccgatgt catcatcacc ggcaacagtt
     2041 tcacgctaac ccatcgcgtt cgcactcatc cgggtcagaa caacagggtg actattccct
     2101 tcctgccggg aggctggacg aagccggatg gtcgcaaggg aacgcgagag gacatcatga
     2161 tgatactggc caatgtggac aatattctga ttcgactggg ctacctggat agcacagctc
     2221 gcgaagtgga tctgataaat atcgccttgg attcggccgg aagtgccgat cagggattgg
     2281 gcagtgcctc gctcgtggag aagtgcacct gtccgcccgg ctatgttggt gattcgtgcg
     2341 agtcctgtgc ctcgggctat gttcgccagg cccgcggacc ttggctgggt cattgtgtgc
     2401 ccttcacccc ggaaccgtgc ccagcgggaa cctacggcaa tccccgactt ggtgttccct
     2461 gccaggagtg tccgtgcccc cacgcgggcg ccaataactt tgccagcggc tgccaacaga
     2521 gtcccgatgg cgatgtgatt tgccgctgca acgaaggcta tgccggcaag aggtgcgagc
     2581 actgcgccca gggttaccag ggtaatccgt tggcaccggg aggagtctgt cgcaagatac
     2641 ccgatagttc gtgcaatgtc gacggcacct acaacatcta cagcaatgga acgtgccagt
     2701 gcaaggatag cgtgattggc gaacagtgcg acacctgcgc gccgaagagt ttccacctca
     2761 attcgttcac ctacaccggt tgcatcgagt gcttctgcag tggagtgggc ttggattgtg
     2821 acagtagttc gtggtatcgc aaccaggtca ccagcacctt tggacgaacg cgcgtcaatc
     2881 atggattcgc cctgattagc gactatatgc gcaatacccc ggtaacggtg cccgtttcca
     2941 tgtccaccca ggccaatgcc ttgagcttcg tgggatccgc cgagcaggcc ggtaatacgc
     3001 tctactggag tcttcccgcc gccttcctgg gcaacaagct gacctcgtac ggaggcaagt
     3061 tgagctacac gctcagctac agtcccctgc ccagcggcat tatgtcgcgc aacagtgccc
     3121 ccgatgtggt gatcaagagc ggcgaggatc tgaggctcat ccattacagg aagtcgcagg
     3181 tcagtcccag tgtggccaac acctatgccg tggagatcaa ggagagcgca tggcagcgcg
     3241 gcgatgaact ggtgcctaac cgtgaacacg tcctgatggc cctcagcaat attacggcca
     3301 tctatatcaa ggccacgtac acgactagca ccaaggaggc ctcgctgcga tcggtcacat
     3361 tggatacggc cacggccacc aatctgggca ccgcacgtgc cgtcgaagtg gagcagtgcc
     3421 gctgtcccga gggctatttg ggtctctcct gcgagcagtg tgctcctggc tatacgcgcg
     3481 atccggaggc aggaatctat ctgggtctct gcaggccctg cgagtgcaat ggacattcca
     3541 agtattgcaa cagtgagaca ggcgaatgcg aaagctgttc cgacaacacc gaaggattca
     3601 attgtgaccg atgcgccgcc ggctatgtgg gtgatgccac ccgaggaact tcgtacgact
     3661 gtcaatacga tgacggcggc tatccgacgt cgcgtccacc ggcaccgggc aatcagacgg
     3721 ccgaatgcct ggtgaattgc caacaggagg gaaccgccgg ttgccgcggc taccagtgcg
     3781 agtgcaagag gaatgtggct ggcgatcgat gcgatcagtg ccgccccgga acctatggac
     3841 tgtcggccca aaatccggac ggttgcaagg agtgctactg ctccggactg accaaccagt
     3901 gccgctcggc gtctctctac cgccagctga tacccgtgga cttcatttcg acgccaccat
     3961 tgataacaga cgaattcggc gacatcatgg atagggataa ccttgtgccc gacgtgccca
     4021 ggaatgtgta tacctacaag cacacctcct acacgcccaa gtactggagc ctgaggggta
     4081 gtgtgctggg caaccagctg ttgtcgtacg gcggccgctt ggagtacagc ctgattgtgg
     4141 agtccgttgg ccgggaccat cgtggcaagg atgtggtcct aattggcaac ggactcaagc
     4201 tgatctggtc gcgacccgat ggccatgaca acgagcagga ataccatgtg cgtttgcatg
     4261 aggacgagca gtggacggtt gaggatcgtg gatcggcacg acaggccacg cgggccgact
     4321 tcatgactgt gctgtcggat ctgcagcaca tcctgatcct ggccacaccc aaggtgccca
     4381 cggtcagcac ctcgattagc aatgtcatcc tggagagttc gataaccacg agagcgcctg
     4441 gagctacgca tgcctccgat atcgagttgt gccagtgtcc atccggttat acgggcactt
     4501 cctgtgagtc ctgcgcacca ctgcactacc gcgacgcctc tggacgctgc agtcagtgtc
     4561 cttgcgacgc ttccaacacg gaatcctgcg gcttggtcag cggcggtaac gtcgaatgcc
     4621 agtgcaggcc acgctggagg ggtgatcgct gccgggaaat tgacacatcg cccattatcg
     4681 aagaaccgcc ccagatatgt gatttaagca ggggattctg ttgcagcggc tttcagttcg
     4741 atatcgcacc gaacgagaca atctcgttta atgacaccct gcagatatat aagggcaaca
     4801 gaatcatagg aaatatgacc aagctgcgct acggctgtcc atcgcgagaa actaacgaac
     4861 cgactccgga accggatacc agtaccgatg atcccgtgcg cacccagatc atagtgtcga
     4921 ttgccaggcc agagattacc attctgcccg tgggtggatc gctgaccctc agctgtaccg
     4981 gtcgaatgcg ctggaccaat agcccagtgt ttgtgaactg gtacaagcag ggcagtcacc
     5041 tgcccgaggg agtcgaggtg caaggcggta atctgcagct gttcaacctg cagatcagcg
     5101 attctggaat ctacatctgc caggccgtaa gcaacgagac cggccacagc tttacggacc
     5161 acgtctccat caccgtttcc caggaggacc aacgctcgcc ggctcacatt gtggatttgc
     5221 ccaacgacgt gaccttcgag gagtacgtaa gcaatgagat cgtctgcgag gtggagggca
     5281 acccaccacc cactgtcacc tggactcgcg tggatggcca tgcggacgcc caaagtacgc
     5341 gaacggacaa caatcggctg gtcttcgatt cgccgaggaa atcggacgag ggtcgctatc
     5401 gctgccaggc agagaatagc ctgagtcggg aggagaagta cgtagtcgtg tatgtccgga
     5461 gcaatcctcc ccagccgccg ccgcagcagg atcgtttgta catcacaccg caggaggtga
     5521 acggtgtggc cggtgactcc ttccagttgt cctgccaatt caccagcgct gcctctctgc
     5581 gctacgattg gtcccacgat ggtcgctccc tgtccgcgtc gtcaccccga aatgttgtgg
     5641 tccgcggaaa tgtcctggaa gtccgcgatg ccaacgttcg cgactccggc acctacacct
     5701 gtgtggcctt cgacctgcgc acccgacgca acttcaccga gagcgcacgg gtctacatcg
     5761 agcagcccaa cgagccggga atccttggcg acaagccgca tatcttgacc ttggagcaga
     5821 acatcataat tgtgcaaggc gaggacttga gcatcacatg tgaggcaagt ggaacgccct
     5881 atccctcgat taagtggacc aaggtgcagg agaatctggc cgaaaatgtc cgcatcagtg
     5941 gcaatgtgct caccatctac ggaggccgca gtgagaatcg tggtctttac tcctgcatcg
     6001 ccgagaactc tcacggcagc gatcagtcca gcacaagcat cgatattgaa ccccgggagc
     6061 ggccgagtct tacgattgat acggccaccc aaaaggtttc ggttggctcc caggcgtccc
     6121 tttactgtgc cgcccagggc attcccgaac cgaccgtcga gtgggttcga acggatggtc
     6181 agccactgtc gccgcgtcac aaggtccagg cacccggcta tgttgtgatc gatgacattg
     6241 tgctcgatga tagcggtacc tacgagtgcc gggcgagcaa catagctggc caggtgagcg
     6301 gcttggccac cattaacgtc caggagccaa ctcttgtgcg gatcgaacca gataggcaac
     6361 accatatcgt cacccagggc gacgaactct cgctcagctg cgtgggcagt ggcgtcccta
     6421 ctccttcggt cttttggagt ttcgagggaa gagacgttga caggatggga gtaccggaag
     6481 gtgctgtttt tgcgcaacct ttccgaacca acactgccga cgtgaaaatc ttccgggtga
     6541 gcaaggagaa cgaaggcatc tacgtctgtc acggatccaa tgacgcgggt gaagatcaac
     6601 aatacattcg cgtggaggta caacccagac ggggtgacgt cggtgcagga ggagatgaca
     6661 atggtgatgt cgatacccga cagcccccca atcggcccca aatccaaccg aatccattga
     6721 gcaacgaacg cctgaccacc gaattgggca acaatgtgac cctcatctgc aacgtggaca
     6781 acgtgaacac ggaatgggaa cgcgtcgatg gcacacccct gccgcacaat gcctacacgg
     6841 tgagaaatac gctggtgatt gtcttcgtgg agccgcagaa tctgggtcag taccgctgca
     6901 atggaatcgg tcgcgatgga cgtgtggagg cccatgtggt gagggagctg gttctcctgc
     6961 ccctgcccag gatcaccttc tatcccaaca tcccgctgac cgtggagctg ggccagaact
     7021 tggatgtcta ctgccaggtg gagaacgtgc gtccggagga cgtgcattgg accaccgaca
     7081 acaatcgacc actgcccagt tccgtacgca tcgagggcaa tgtcctcagg ttcgcgtcca
     7141 tcactcaggc tgctgccggt gaataccgct gctcggccac caatcaatat ggaagccgat
     7201 cgaagaacgc cagggtggtg gtgaaacagc ccagtggctt ccagcccgtt ccccactcgc
     7261 aggtgcaaca gcgtcaggtg ggcgactcca tccagttgcg atgccgcctg accacccagt
     7321 acggcgacga ggttcgcggc aatatccagt tcaactggta ccgtgaggac ggcagcccct
     7381 tgccccgcgg tgtccgtccg gatagccagg tgctgcagct ggttaaattg cagcccgagg
     7441 acgagggccg ctacatctgc aactcgtacg atttgggcag cgggcagcaa ctgccccccg
     7501 tctccatcga cttgcaagta ctaagaacta ctacccagta tcctttcaat cggtttaagg
     7561 gcggtgtctc cctgaaagac acgccctgca tggttctgta tatttgtgca gcggtaccag
     7621 cggctcccca gaaccccatc tacctgccgc cagtggcgcc accacgttcg cccgaaagga
     7681 tcctcgagcc ccaactgagc ctgagtgtac aatcctcgaa cctgccagcc ggcgacggca
     7741 ccaccgtcga gtgcttctcc tccgatgact cctacccaga tgtcgtgtgg gaacgcgccg
     7801 atggagctcc actcagcgaa aatgtccagc aagtgggcaa taacctggtg attagtaacg
     7861 tggcctccac cgatgccggt aactatgtgt gcaagtgcaa gacggacgag ggagatctgt
     7921 ataccaccag ctacaaactg gaggtcgagg agcagcccca tgaactgaag agctccaaga
     7981 tagtctacgc caaggttggc ggaaatgccg acttgcagtg cggagccgat gaagatcgac
     8041 agcccagcta ccgttggtct cgccaatacg gacaacttca ggcgggacgc agtctgcaga
     8101 atgagaaact ttcgttggat cgcgttcagg ccaacgatgc cggaacttat gtttgttcgg
     8161 cccaatacag cgatggcgag acggttgact tccccaacat tctggttgtg accggggcga
     8221 ttccccagtt ccgccaggag ccccgcagct acatgagctt ccccacgctc tcgaactcct
     8281 cgttcaagtt caacttcgag ctgaccttcc ggccggaaaa cgccgacgga ctgctgctct
     8341 tcaatggaca gacccgcgga agcggtgact atatcgcact ctcgctgaag gatcgctatg
     8401 cggagttccg gttcgatttt ggcggtaaac cgttgctggt gcgagcggag gagccactgg
     8461 ctttggatga atggcacacg gtgcgcgtga gtcgcttcaa gcgggatggc tacatccagg
     8521 tggacgacca gcatccggtg gccttcccca cctcccagca tcagcagata ccccagttgg
     8581 aactgattga ggatctgtac attggcggcg tgcccaactg ggagttcctg cccgccgagg
     8641 cggtgggtca gcaatcaggc ttcgtgggct gcattagccg gctgaccctg cagggacgca
     8701 ccgtggagct gatccgggag gccaagttca aggagggcat caccgattgc cggccctgcg
     8761 cccagggacc ctgccagaac aagggcgtct gcctggagag ccagacggag caggcctaca
     8821 cctgcgtctg ccagccgggc tggactggcc gggattgtgc catcgagggc acccagtgca
     8881 ccgcaggagt ttgcggctcg ggacgctgcg agaatacgga gaacgacatg gagtgcctgt
     8941 gcccgctgaa cagggcaggc gatcgatgcc agtacaatga gattctaaat gaacagagct
     9001 tgaatttcaa gagcaacagc tttgcggcct acggaactcc caaggtcacc aaagtaaaca
     9061 tcacactctc cgttcgtccc gcgagcctgg aggactctgt gatcctgtac acggcggaat
     9121 ccactctgcc cagcggcgat tacctggctt tggtccttcg cggtggccac gcggagctgc
     9181 tgatcaacac ggccgcccgc ttggatcccg tggtggtgcg ttcggcggaa ccgctgcccc
     9241 tcaatcgctg gaccagaatc gagatcaggc gtcgcctggg cgagggaatc ctcaaggtgg
     9301 gcgatggacc cgagcgaaag gccaaggcac cgggatccga tcgcattctg tcgctcaaga
     9361 cccacctctt tgtgggcggc gtcgatcggt cgaccgtaaa gatcaaccgt gatgtgaaca
     9421 tcaccaaggg cttcgatggc tgcatctcga agctgtacaa ctcgcagaaa tccgtcaatc
     9481 tgctgggtga catcagggat gcggcgaatg tccagaactg tggggaggcg aatgagatag
     9541 atgacgatga gtatgagatg ccagtagcgc tgccatcgcc taaggtcgcc gagaatgaac
     9601 gtcagctgat ggcgccgtgt gccagtgatc cctgcgagaa cgggggaagc tgcagcgagc
     9661 aggaggacat ggccatctgc tcctgtccct tcggcttcag cggcaaacac tgccagaatc
     9721 acctccagct gagcttcaat gcctcgttcc gcggcgatgg ctacgtggag ctgaaccgca
     9781 gccacttcca acccgccctg gagcagacgt actcccacat tggcattgtg ttcaccacca
     9841 acaagccgaa tggcctgctt ttctggtggg gccaggaggc cggggaggag tacaccggac
     9901 aggacttcat tgccgccgcc gtggtcgatg gctatgtgga gtactcgatg aggctcgatg
     9961 gcgaggaggc ggtcattcgg aacagcgata tccgcgtgga caatggcgag cggcacattg
    10021 tgatcgccaa gcgggatgag aacaccgcca tgctggaact cgatcagatc ctggacacgg
    10081 gcgatacgcg acccaccatc aacaaggcaa tgaagctgcc gggcaatgtg tttgtcggtg
    10141 gcgctcctga tgtcgcggca ttcacgggct tccgctacaa ggacaatttc aacggctgca
    10201 ttgtggtcgt cgagggcgaa accgtgggcc aaattaacct tagttcagct gccatcaatg
    10261 gagtgaatgc caacgtgtgt cccgctaacg acgaacctct gggaggaacc gaaccgccag
    10321 tcgtctgagg acacaaccag caaccgaaat tagcttttta attaaacatt aacaaatgaa
    10381 acaaaaagaa aaacaatttt tatatataca acatatgaat aagccccaag caaacctaca
    10441 aaaaattgaa tattatacga cgaacagata atataaaaac aaaaaaagag agaaacgatc
    10501 acttctacta caattgcttc ttcgatcctt aagtctaggt taaagattgt agcaagaaaa
    10561 caagcgaata tcacaaacat ttatttaaca agaacgccat gcgagaagtg aaacgaaaca
    10621 gaaacaataa tgcaattaat gcagataata cagataaagc ctagaaccct aagaactaac
    10681 taactaactc gaacaagaac aacaacgcat actagccaac tgcaaccaca acaaccacaa
    10741 tagtgaaggc attttaatta taattttagt ctctagctta taactatgac tacgactcgt
    10801 tttttttgtg agcccagtgt aaaatgttgg aaatcggaaa ttggccctac acacaaacac
    10861 acacaagtta ttaattaaat accaattgat accatataat gataaatgaa atactatgaa
    10921 tgcaactatt gtgaacgaac gaaaaccgtt gagtggataa aaagcataag cagaagatat
    10981 attaaaatga aatcaacaac a