Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii terribly reduced optic lobes


LOCUS       XM_070218440           12665 bp    mRNA    linear   INV 09-DEC-2024
            (trol), transcript variant X26, mRNA.
ACCESSION   XM_070218440
VERSION     XM_070218440.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..12665
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..12665
                     /gene="trol"
                     /note="terribly reduced optic lobes; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 7
                     Proteins"
                     /db_xref="GeneID:108055788"
     CDS             209..11992
                     /gene="trol"
                     /codon_start=1
                     /product="basement membrane-specific heparan sulfate
                     proteoglycan core protein isoform X26"
                     /protein_id="XP_070074541.1"
                     /db_xref="GeneID:108055788"
                     /translation="MGSPGSQAPAIAIGISNGRRGHTGSLLLRLLLVAFVLNACHVPP
                     TNAKQITKSKVDDQDFILADTQSLQGSVDLDDDEAFLIPPDSEEKLDKKFTPEGNWWS
                     QGLHRVRRSLNSFFGSDDDDQEKERERQRQRQNNRDAANRQKELRRQQKESQNREKQL
                     RLERQERQRLAKRNNHVVFNRVTDPRKRASDLYDENEASGLNEEETTTYRTYFVVNEP
                     YSDDYKERDSLQFQNLQKLLDEDLRNFFNRNFENNDDEEQEIHSTLERVDQTKDHFKI
                     RVQLRVDLPSSINDFGSKLEQQLNVYKRIDRLGASTDGVFTFTESSVYKYEHQYDIVT
                     PRVIVSGQPITEKPVEAPQEFDEDPIEVALPTDEVEGSGQDSGSCRGDATFQCRRSGK
                     TICDEMRCDGSRDCPDAEDEEGCEVCNELQFKCDNKCLPLNKRCDNRYDCEDQTDEAG
                     CQRYEVEESQPQPQPQPQPEPEPEPEPEPEPEPEPEPEPEEPITDNEQPEQNSECRAT
                     EFRCNNGDCIDIRKRCDHISDCSEGEDENEECPTTRLKPSDCGPDQFFCDDLCYNRSI
                     RCNGHMDCSDGSDEIACSSLSVLPCPQHQCPSGRCYSESERCDRHRHCEDGSDEANCC
                     YADQFRCNNGDCIAESAHCDGNIDCSDQSDELDCGGDSQCLPNQFRCKNGQCVSSTAR
                     CNKRSDCLDGSDEQNCANEPNNSGRGTNQLKLKTYPDNQIIKESREVIFRCRDEGPNR
                     AKVKWSRPGGRPLPPGFTDRNGRLEIPNIRVEDAGAYVCEAVGYANYIPGQHVTVNLN
                     VERLNEREIRPDSACTEYQATCMNGECIDKSGICDGHPDCSDGSDEHSCSLGLKCQPN
                     QFMCSNSKCVDRTWRCDGENDCGDNSDETSCDPEPSDAPCRYDEFQCRSGHCIPKSFQ
                     CDYMNDCTDGTDEIGCSVPSPMTLPAPSIVVMEYEVLELTCVGTGVPTPTIVWRLNWG
                     HVPEKCESKSYGGTGTLRCPNMRPQDSGAYSCEFINTRGTFYPKTNSIVTVTPVRSDV
                     CKAGFFNMLARKSEECVQCFCFGVSTNCDSANLFTYAIQPPILSHRVVSVELSPFRQI
                     VINEASPGQDLLTLHHGVQFRASNVHYNGRETPFLALPAEYMGNQLKSYGGNLRYEVR
                     YNGNGRPVSGPDVIITGNSFTLTHRVRTHPGQNNRVTIPFLPGGWTKPDGRKGTREDI
                     MMILANVDNILIRLGYLDSTAREVDLINIALDSAGSADQGLGSASLVEKCTCPPGYVG
                     DSCESCASGYVRQARGPWLGHCVPFTPEPCPAGTYGNPRLGVPCQECPCPHAGANNFA
                     SGCQQSPDGDVICRCNEGYAGKRCEHCAQGYQGNPLAPGGVCRKIPDSSCNVDGTYNI
                     YSNGTCQCKDSVIGEQCDTCAPKSFHLNSFTYTGCIECFCSGVGLDCDSSSWYRNQVT
                     STFGRTRVNHGFALISDYMRNTPVTVPVSMSTQANALSFVGSAEQAGNTLYWSLPAAF
                     LGNKLTSYGGKLSYTLSYSPLPSGIMSRNSAPDVVIKSGEDLRLIHYRKSQVSPSVAN
                     TYAVEIKESAWQRGDELVPNREHVLMALSNITAIYIKATYTTSTKEASLRSVTLDTAT
                     ATNLGTARAVEVEQCRCPEGYLGLSCEQCAPGYTRDPEAGIYLGLCRPCECNGHSKYC
                     NSETGECESCSDNTEGFNCDRCAAGYVGDATRGTSYDCQYDDGGYPTSRPPAPGNQTA
                     ECLVNCQQEGTAGCRGYQCECKRNVAGDRCDQCRPGTYGLSAQNPDGCKECYCSGLTN
                     QCRSASLYRQLIPVDFISTPPLITDEFGDIMDRDNLVPDVPRNVYTYKHTSYTPKYWS
                     LRGSVLGNQLLSYGGRLEYSLIVESVGRDHRGKDVVLIGNGLKLIWSRPDGHDNEQEY
                     HVRLHEDEQWTVEDRGSARQATRADFMTVLSDLQHILILATPKVPTVSTSISNVILES
                     SITTRAPGATHASDIELCQCPSGYTGTSCESCAPLHYRDASGRCSQCPCDASNTESCG
                     LVSGGNVECQCRPRWRGDRCREIDTSPIIEEPPQICDLSRGFCCSGFQFDIAPNETIS
                     FNDTLQIYKGNRIIGNMTKLRYGCPSRETNEPTPEPDTSTDDPVRTQIIVSIARPEIT
                     ILPVGGSLTLSCTGRMRWTNSPVFVNWYKQGSHLPEGVEVQGGNLQLFNLQISDSGIY
                     ICQAVSNETGHSFTDHVSITVSQEDQRSPAHIVDLPNDVTFEEYVSNEIVCEVEGNPP
                     PTVTWTRVDGHADAQSTRTDNNRLVFDSPRKSDEGRYRCQAENSLSREEKYVVVYVRS
                     NPPQPPPQQDRLYITPQEVNGVAGDSFQLSCQFTSAASLRYDWSHDGRSLSASSPRNV
                     VVRGNVLEVRDANVRDSGTYTCVAFDLRTRRNFTESARVYIEQPNEPGILGDKPHILT
                     LEQNIIIVQGEDLSITCEASGTPYPSIKWTKVQENLAENVRISGNVLTIYGGRSENRG
                     LYSCIAENSHGSDQSSTSIDIEPRERPSLTIDTATQKVSVGSQASLYCAAQGIPEPTV
                     EWVRTDGQPLSPRHKVQAPGYVVIDDIVLDDSGTYECRASNIAGQVSGLATINVQEPT
                     LVRIEPDRQHHIVTQGDELSLSCVGSGVPTPSVFWSFEGRDVDRMGVPEGAVFAQPFR
                     TNTADVKIFRVSKENEGIYVCHGSNDAGEDQQYIRVEVQPRRGDVGAGGDDNGDVDTR
                     QPPNRPQIQPNPLSNERLTTELGNNVTLICNVDNVNTEWERVDGTPLPHNAYTVRNTL
                     VIVFVEPQNLGQYRCNGIGRDGRVEAHVVRELVLLPLPRITFYPNIPLTVELGQNLDV
                     YCQVENVRPEDVHWTTDNNRPLPSSVRIEGNVLRFASITQAAAGEYRCSATNQYGSRS
                     KNARVVVKQPSGFQPVPHSQVQQRQVGDSIQLRCRLTTQYGDEVRGNIQFNWYREDGS
                     PLPRGVRPDSQVLQLVKLQPEDEGRYICNSYDLGSGQQLPPVSIDLQVLRTTTQYPFN
                     RFKGGVSLKDTPCMVLYICAAVPAAPQNPIYLPPVAPPRSPERILEPQLSLSVQSSNL
                     PAGDGTTVECFSSDDSYPDVVWERADGAPLSENVQQVGNNLVISNVASTDAGNYVCKC
                     KTDEGDLYTTSYKLEVEEQPHELKSSKIVYAKVGGNADLQCGADEDRQPSYRWSRQYG
                     QLQAGRSLQNEKLSLDRVQANDAGTYVCSAQYSDGETVDFPNILVVTGAIPQFRQEPR
                     SYMSFPTLSNSSFKFNFELTFRPENADGLLLFNGQTRGSGDYIALSLKDRYAEFRFDF
                     GGKPLLVRAEEPLALDEWHTVRVSRFKRDGYIQVDDQHPVAFPTSQHQQIPQLELIED
                     LYIGGVPNWEFLPAEAVGQQSGFVGCISRLTLQGRTVELIREAKFKEGITDCRPCAQG
                     PCQNKGVCLESQTEQAYTCVCQPGWTGRDCAIEGTQCTAGVCGSGRCENTENDMECLC
                     PLNRAGDRCQYNEILNEQSLNFKSNSFAAYGTPKVTKVNITLSVRPASLEDSVILYTA
                     ESTLPSGDYLALVLRGGHAELLINTAARLDPVVVRSAEPLPLNRWTRIEIRRRLGEGI
                     LKVGDGPERKAKAPGSDRILSLKTHLFVGGVDRSTVKINRDVNITKGFDGCISKLYNS
                     QKSVNLLGDIRDAANVQNCGEANEIDDDEYEMPVALPSPKVAENERQLMAPCASDPCE
                     NGGSCSEQEDMAICSCPFGFSGKHCQNHLQLSFNASFRGDGYVELNRSHFQPALEQTY
                     SHIGIVFTTNKPNGLLFWWGQEAGEEYTGQDFIAAAVVDGYVEYSMRLDGEEAVIRNS
                     DIRVDNGERHIVIAKRDENTAMLELDQILDTGDTRPTINKAMKLPGNVFVGGAPDVAA
                     FTGFRYKDNFNGCIVVVEGETVGQINLSSAAINGVNANVCPANDEPLGGTEPPVV"
     misc_feature    458..>715
                     /gene="trol"
                     /note="Coiled-coil domain-containing protein 66; Region:
                     CCDC66; pfam15236"
                     /db_xref="CDD:434558"
     misc_feature    1361..1453
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1361..1363,1388..1390,1421..1426)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1400..1402,1409..1411,1421..1423,1439..1444)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1430..1444
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1460..1561
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1475..1477,1496..1498,1529..1534)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1508..1510,1517..1519,1529..1531,1547..1552)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1538..1552
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1718..1816
                     /gene="trol"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(1736..1738,1760..1762,1793..1798)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1772..1774,1781..1783,1793..1795,1811..1816)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1802..1816
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1856..1957
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1871..1873,1892..1894,1925..1930)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1904..1906,1913..1915,1925..1927,1943..1948)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1934..1948
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1985..2077
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1988..1990,2012..2014,2045..2050)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2024..2026,2033..2035,2045..2047,2063..2068)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2054..2068
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2078..2182
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2093..2095,2117..2119,2150..2155)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2129..2131,2138..2140,2150..2152,2168..2173)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2159..2173
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2198..2302
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2213..2215,2237..2239,2270..2275)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2249..2251,2258..2260,2270..2272,2288..2293)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2279..2293
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2345..2551
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    2645..2749
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2660..2662,2684..2686,2717..2722)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2696..2698,2705..2707,2717..2719,2735..2740)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2726..2740
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2765..2869
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2780..2782,2804..2806,2837..2842)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2816..2818,2825..2827,2837..2839,2855..2860)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2846..2860
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2894..2998
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2909..2911,2933..2935,2966..2971)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2945..2947,2954..2956,2966..2968,2984..2989)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2975..2989
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3050..3277
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    3059..3073
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    3098..3112
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    3167..3181
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    3209..3226
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    3251..3262
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    3572..3964
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    4133..4294
                     /gene="trol"
                     /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053"
                     /db_xref="CDD:395007"
     misc_feature    order(4133..4135,4139..4141,4175..4177,4205..4207,
                     4211..4213,4238..4240)
                     /gene="trol"
                     /note="EGF-like motif [active]"
                     /db_xref="CDD:238012"
     misc_feature    4313..4426
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domai;
                     Region: EGF_Lam; smart00180"
                     /db_xref="CDD:214543"
     misc_feature    4667..5077
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    <5078..5158
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domain;
                     laminins are the major noncollagenous components of
                     basement membranes that mediate cell adhesion, growth
                     migration, and differentiation; the laminin-type epidermal
                     growth factor-like module occurs in...; Region: EGF_Lam;
                     cd00055"
                     /db_xref="CDD:238012"
     misc_feature    5180..5329
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domain;
                     laminins are the major noncollagenous components of
                     basement membranes that mediate cell adhesion, growth
                     migration, and differentiation; the laminin-type epidermal
                     growth factor-like module occurs in...; Region: EGF_Lam;
                     cd00055"
                     /db_xref="CDD:238012"
     misc_feature    order(5183..5185,5189..5191,5210..5212,5231..5233,
                     5240..5242,5267..5269)
                     /gene="trol"
                     /note="EGF-like motif [active]"
                     /db_xref="CDD:238012"
     misc_feature    <5438..5530
                     /gene="trol"
                     /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053"
                     /db_xref="CDD:395007"
     misc_feature    5726..6130
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    6593..6841
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    6626..6640
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    6674..6688
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    6731..6745
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    6773..6790
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    6818..6829
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    <6920..7081
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    7172..7423
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    7205..7219
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    7244..7258
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    7313..7327
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    7355..7372
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    7460..7702
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    7511..7525
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409570"
     misc_feature    7550..7564
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409570"
     misc_feature    7607..7621
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409570"
     misc_feature    7649..7666
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409570"
     misc_feature    7688..7699
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409570"
     misc_feature    7754..7984
                     /gene="trol"
                     /note="Immunoglobulin I-set domain; Region: I-set;
                     pfam07679"
                     /db_xref="CDD:400151"
     misc_feature    7778..7792
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    7817..7831
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    7880..7894
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    7922..7939
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    7961..7972
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    8021..8284
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    8051..8065
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    8090..8104
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    8222..8239
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    8657..8887
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    8684..8698
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    8723..8737
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    8783..8797
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    8825..8842
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    8921..>9124
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    8954..8968
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    9002..9025
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    9071..9085
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    9353..9559
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    9647..9847
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    9671..9685
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    9710..9724
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    9767..9781
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    9809..9826
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    9911..10354
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     misc_feature    10421..10519
                     /gene="trol"
                     /note="EGF-like domain; Region: EGF; pfam00008"
                     /db_xref="CDD:394967"
     misc_feature    10661..11122
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     misc_feature    11282..11380
                     /gene="trol"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    11405..11866
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     polyA_site      12665
                     /gene="trol"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attaggttgc gcgccatcgt tccaggcggt cgcacattcc acgtgccata gccgtaacaa
       61 caacctgcca accgcttaaa accaaactca aatacgaacc gaaactgcct tcacacacac
      121 aagtacctaa accaaatcta aatagctgcc aaaagaaacc aaaaattcca gagacgtcgt
      181 agcatccgtt ccccggaaga agaagaagat gggatcgccg ggatcccaag cgcccgcgat
      241 cgcgatcggg atcagtaacg ggcggagagg tcacacgggg tcgctgctcc tgcgcctcct
      301 tctcgtggcc ttcgtcctca acgcctgcca cgtacccccg accaatgcca agcaaattac
      361 gaaaagtaaa gttgatgacc aggactttat actggccgac acacaatcgc tgcagggcag
      421 cgttgacctt gacgatgacg aagcgttcct gattcctccg gattccgaag agaagttgga
      481 taagaagttc acgccggagg gcaactggtg gagccagggg ctccatcgtg ttcgccgctc
      541 cctaaatagc ttcttcggct ccgacgacga tgatcaggaa aaggaacgtg agcgtcagag
      601 gcaaaggcaa aataatcgcg atgccgccaa ccggcaaaag gaacttcggc gccagcaaaa
      661 ggagagccag aaccgcgaga agcagctgcg attggagcgc caggagaggc agcgccttgc
      721 caagcggaac aatcacgtgg tcttcaatcg cgtcaccgat ccccgcaagc gggcatccga
      781 cctttacgac gagaacgagg catctggcct aaacgaggag gaaaccacca cctatcgcac
      841 ctactttgtt gttaatgagc catattcaga cgactacaag gagcgggaca gcctccagtt
      901 ccagaatctg caaaaacttc ttgacgagga cctgcgcaac ttcttcaatc gcaatttcga
      961 aaataacgat gatgaagagc aggaaatcca tagcacccta gagcgagtcg atcaaaccaa
     1021 ggaccatttt aaaattcgcg tgcaacttag ggtagatctg cccagttcaa tcaacgactt
     1081 tggaagtaag ttggagcaac aactgaatgt ctacaagcga atcgatcgtt tgggtgccag
     1141 taccgatggc gtcttcacct ttaccgaatc gagcgtctac aaatacgaac accaatacga
     1201 tattgtgaca ccgagagtaa ttgtatctgg acaaccgata actgaaaaac cagtcgaagc
     1261 accccaagaa ttcgatgagg atcctatcga agttgcattg cccacggatg aggtggaggg
     1321 ctccggccaa gattccggta gctgtcgcgg cgatgccacc ttccagtgtc gaaggagtgg
     1381 aaagactatt tgcgatgaaa tgcgatgcga tggatctcgc gattgtcccg atgccgagga
     1441 cgaggaaggc tgcgaggttt gcaacgaact tcagttcaag tgcgataaca agtgtctgcc
     1501 gctcaataag cgctgcgata atcgatacga ttgtgaggat cagacggacg aggctggttg
     1561 tcaacggtac gaagtagaag agtctcagcc tcagccgcag ccgcaacctc agcctgaacc
     1621 ggaacctgaa cctgaacctg agcctgagcc tgaacctgaa ccagaaccag aacctgaaga
     1681 gcctataaca gacaatgaac agcctgagca aaactcagaa tgccgggcca ccgagttcag
     1741 atgcaacaat ggggactgca tcgatattag aaagcgttgc gatcacattt cggactgtag
     1801 cgaaggcgag gacgagaacg aggagtgccc caccacacga ctaaagccca gcgactgcgg
     1861 tccggatcag ttcttctgcg atgatttatg ctataatcgc tctattcgat gcaatggcca
     1921 tatggattgc tcagatggca gtgatgagat cgcttgtagc tcgctgtcag tgcttccatg
     1981 tccacagcac cagtgtccca gtggcaggtg ttattcggaa agtgagcgat gcgatcgcca
     2041 caggcactgc gaggatggct ccgatgaggc caactgctgt tacgcggatc aattccgctg
     2101 caataatggt gactgcattg cggaatcggc tcattgcgat ggaaatatcg attgtagcga
     2161 ccagtccgat gaactcgact gcggaggaga ctcgcagtgt ctgcccaacc aattccgctg
     2221 caagaatggc caatgtgtga gctctacagc gcgttgcaac aagcgttccg attgtttgga
     2281 tggctccgat gagcagaatt gtgccaatga acctaacaac tccggacgtg gaacgaacca
     2341 attgaaactc aagacctatc ccgacaacca aatcattaag gagagtcgtg aggtcatctt
     2401 ccgttgccgt gacgaaggtc ccaaccgcgc caaggtcaag tggtcgcgac ccggcggacg
     2461 tcccctgccc cccggtttca ccgatcgcaa tggccgcctg gagatcccca acatcagggt
     2521 ggaggatgct ggcgcctatg tctgcgaggc cgtgggctat gccaactata ttcccggtca
     2581 gcacgtcacc gtaaacctca acgtcgagcg cttaaacgaa cgcgaaatcc gtccggactc
     2641 agcctgtacg gagtaccagg ccacctgcat gaacggcgag tgtatcgata agtcgggcat
     2701 ctgcgatgga catccggact gttcggatgg ctccgatgag cacagctgca gtttgggttt
     2761 gaagtgtcag cccaaccagt tcatgtgctc caattccaag tgtgtggatc gcacctggcg
     2821 ctgtgatggc gagaacgact gcggcgataa ctccgatgag acctcttgcg atccggaacc
     2881 aagtgatgct ccgtgccgat acgacgaatt ccagtgccgc agcggtcatt gcattcccaa
     2941 gagcttccag tgcgactata tgaacgattg taccgatggt accgatgaaa ttggatgctc
     3001 ggtgccctct ccaatgaccc tacccgcacc ctcgattgtc gtgatggagt acgaggtcct
     3061 cgagctgacc tgcgtgggca ccggcgtccc gacgccgacg atcgtgtggc gtctcaactg
     3121 gggccatgtg cccgagaagt gtgaatcgaa gagctacggc ggaaccggaa ccctgcgctg
     3181 tccgaacatg aggccccagg acagtggtgc ctactcgtgc gagttcatca acacacgcgg
     3241 caccttctat ccgaaaacga actcgattgt caccgttacg ccggtgcgct cggatgtctg
     3301 caaggccgga ttcttcaata tgctggcccg caagtcggag gaatgcgtcc agtgcttctg
     3361 ctttggcgtt tcgaccaact gtgacagtgc caatttgttc acctacgcca ttcagccacc
     3421 gatcctttcg caccgcgtgg tcagcgttga actcagtccg ttccgtcaaa ttgtcatcaa
     3481 tgaggctagt ccgggtcagg atctgctcac cttgcaccat ggtgttcagt tcagggcatc
     3541 gaacgtacac tacaacggcc gggagacacc attcttggcc ctgcccgctg agtatatggg
     3601 caaccagctg aagtcctatg gcggcaatct gcgctacgag gtcaggtaca atggcaacgg
     3661 tagaccggtc agcggacccg atgtcatcat caccggcaac agtttcacgc taacccatcg
     3721 cgttcgcact catccgggtc agaacaacag ggtgactatt cccttcctgc cgggaggctg
     3781 gacgaagccg gatggtcgca agggaacgcg agaggacatc atgatgatac tggccaatgt
     3841 ggacaatatt ctgattcgac tgggctacct ggatagcaca gctcgcgaag tggatctgat
     3901 aaatatcgcc ttggattcgg ccggaagtgc cgatcaggga ttgggcagtg cctcgctcgt
     3961 ggagaagtgc acctgtccgc ccggctatgt tggtgattcg tgcgagtcct gtgcctcggg
     4021 ctatgttcgc caggcccgcg gaccttggct gggtcattgt gtgcccttca ccccggaacc
     4081 gtgcccagcg ggaacctacg gcaatccccg acttggtgtt ccctgccagg agtgtccgtg
     4141 cccccacgcg ggcgccaata actttgccag cggctgccaa cagagtcccg atggcgatgt
     4201 gatttgccgc tgcaacgaag gctatgccgg caagaggtgc gagcactgcg cccagggtta
     4261 ccagggtaat ccgttggcac cgggaggagt ctgtcgcaag atacccgata gttcgtgcaa
     4321 tgtcgacggc acctacaaca tctacagcaa tggaacgtgc cagtgcaagg atagcgtgat
     4381 tggcgaacag tgcgacacct gcgcgccgaa gagtttccac ctcaattcgt tcacctacac
     4441 cggttgcatc gagtgcttct gcagtggagt gggcttggat tgtgacagta gttcgtggta
     4501 tcgcaaccag gtcaccagca cctttggacg aacgcgcgtc aatcatggat tcgccctgat
     4561 tagcgactat atgcgcaata ccccggtaac ggtgcccgtt tccatgtcca cccaggccaa
     4621 tgccttgagc ttcgtgggat ccgccgagca ggccggtaat acgctctact ggagtcttcc
     4681 cgccgccttc ctgggcaaca agctgacctc gtacggaggc aagttgagct acacgctcag
     4741 ctacagtccc ctgcccagcg gcattatgtc gcgcaacagt gcccccgatg tggtgatcaa
     4801 gagcggcgag gatctgaggc tcatccatta caggaagtcg caggtcagtc ccagtgtggc
     4861 caacacctat gccgtggaga tcaaggagag cgcatggcag cgcggcgatg aactggtgcc
     4921 taaccgtgaa cacgtcctga tggccctcag caatattacg gccatctata tcaaggccac
     4981 gtacacgact agcaccaagg aggcctcgct gcgatcggtc acattggata cggccacggc
     5041 caccaatctg ggcaccgcac gtgccgtcga agtggagcag tgccgctgtc ccgagggcta
     5101 tttgggtctc tcctgcgagc agtgtgctcc tggctatacg cgcgatccgg aggcaggaat
     5161 ctatctgggt ctctgcaggc cctgcgagtg caatggacat tccaagtatt gcaacagtga
     5221 gacaggcgaa tgcgaaagct gttccgacaa caccgaagga ttcaattgtg accgatgcgc
     5281 cgccggctat gtgggtgatg ccacccgagg aacttcgtac gactgtcaat acgatgacgg
     5341 cggctatccg acgtcgcgtc caccggcacc gggcaatcag acggccgaat gcctggtgaa
     5401 ttgccaacag gagggaaccg ccggttgccg cggctaccag tgcgagtgca agaggaatgt
     5461 ggctggcgat cgatgcgatc agtgccgccc cggaacctat ggactgtcgg cccaaaatcc
     5521 ggacggttgc aaggagtgct actgctccgg actgaccaac cagtgccgct cggcgtctct
     5581 ctaccgccag ctgatacccg tggacttcat ttcgacgcca ccattgataa cagacgaatt
     5641 cggcgacatc atggataggg ataaccttgt gcccgacgtg cccaggaatg tgtataccta
     5701 caagcacacc tcctacacgc ccaagtactg gagcctgagg ggtagtgtgc tgggcaacca
     5761 gctgttgtcg tacggcggcc gcttggagta cagcctgatt gtggagtccg ttggccggga
     5821 ccatcgtggc aaggatgtgg tcctaattgg caacggactc aagctgatct ggtcgcgacc
     5881 cgatggccat gacaacgagc aggaatacca tgtgcgtttg catgaggacg agcagtggac
     5941 ggttgaggat cgtggatcgg cacgacaggc cacgcgggcc gacttcatga ctgtgctgtc
     6001 ggatctgcag cacatcctga tcctggccac acccaaggtg cccacggtca gcacctcgat
     6061 tagcaatgtc atcctggaga gttcgataac cacgagagcg cctggagcta cgcatgcctc
     6121 cgatatcgag ttgtgccagt gtccatccgg ttatacgggc acttcctgtg agtcctgcgc
     6181 accactgcac taccgcgacg cctctggacg ctgcagtcag tgtccttgcg acgcttccaa
     6241 cacggaatcc tgcggcttgg tcagcggcgg taacgtcgaa tgccagtgca ggccacgctg
     6301 gaggggtgat cgctgccggg aaattgacac atcgcccatt atcgaagaac cgccccagat
     6361 atgtgattta agcaggggat tctgttgcag cggctttcag ttcgatatcg caccgaacga
     6421 gacaatctcg tttaatgaca ccctgcagat atataagggc aacagaatca taggaaatat
     6481 gaccaagctg cgctacggct gtccatcgcg agaaactaac gaaccgactc cggaaccgga
     6541 taccagtacc gatgatcccg tgcgcaccca gatcatagtg tcgattgcca ggccagagat
     6601 taccattctg cccgtgggtg gatcgctgac cctcagctgt accggtcgaa tgcgctggac
     6661 caatagccca gtgtttgtga actggtacaa gcagggcagt cacctgcccg agggagtcga
     6721 ggtgcaaggc ggtaatctgc agctgttcaa cctgcagatc agcgattctg gaatctacat
     6781 ctgccaggcc gtaagcaacg agaccggcca cagctttacg gaccacgtct ccatcaccgt
     6841 ttcccaggag gaccaacgct cgccggctca cattgtggat ttgcccaacg acgtgacctt
     6901 cgaggagtac gtaagcaatg agatcgtctg cgaggtggag ggcaacccac cacccactgt
     6961 cacctggact cgcgtggatg gccatgcgga cgcccaaagt acgcgaacgg acaacaatcg
     7021 gctggtcttc gattcgccga ggaaatcgga cgagggtcgc tatcgctgcc aggcagagaa
     7081 tagcctgagt cgggaggaga agtacgtagt cgtgtatgtc cggagcaatc ctccccagcc
     7141 gccgccgcag caggatcgtt tgtacatcac accgcaggag gtgaacggtg tggccggtga
     7201 ctccttccag ttgtcctgcc aattcaccag cgctgcctct ctgcgctacg attggtccca
     7261 cgatggtcgc tccctgtccg cgtcgtcacc ccgaaatgtt gtggtccgcg gaaatgtcct
     7321 ggaagtccgc gatgccaacg ttcgcgactc cggcacctac acctgtgtgg ccttcgacct
     7381 gcgcacccga cgcaacttca ccgagagcgc acgggtctac atcgagcagc ccaacgagcc
     7441 gggaatcctt ggcgacaagc cgcatatctt gaccttggag cagaacatca taattgtgca
     7501 aggcgaggac ttgagcatca catgtgaggc aagtggaacg ccctatccct cgattaagtg
     7561 gaccaaggtg caggagaatc tggccgaaaa tgtccgcatc agtggcaatg tgctcaccat
     7621 ctacggaggc cgcagtgaga atcgtggtct ttactcctgc atcgccgaga actctcacgg
     7681 cagcgatcag tccagcacaa gcatcgatat tgaaccccgg gagcggccga gtcttacgat
     7741 tgatacggcc acccaaaagg tttcggttgg ctcccaggcg tccctttact gtgccgccca
     7801 gggcattccc gaaccgaccg tcgagtgggt tcgaacggat ggtcagccac tgtcgccgcg
     7861 tcacaaggtc caggcacccg gctatgttgt gatcgatgac attgtgctcg atgatagcgg
     7921 tacctacgag tgccgggcga gcaacatagc tggccaggtg agcggcttgg ccaccattaa
     7981 cgtccaggag ccaactcttg tgcggatcga accagatagg caacaccata tcgtcaccca
     8041 gggcgacgaa ctctcgctca gctgcgtggg cagtggcgtc cctactcctt cggtcttttg
     8101 gagtttcgag ggaagagacg ttgacaggat gggagtaccg gaaggtgctg tttttgcgca
     8161 acctttccga accaacactg ccgacgtgaa aatcttccgg gtgagcaagg agaacgaagg
     8221 catctacgtc tgtcacggat ccaatgacgc gggtgaagat caacaataca ttcgcgtgga
     8281 ggtacaaccc agacggggtg acgtcggtgc aggaggagat gacaatggtg atgtcgatac
     8341 ccgacagccc cccaatcggc cccaaatcca accgaatcca ttgagcaacg aacgcctgac
     8401 caccgaattg ggcaacaatg tgaccctcat ctgcaacgtg gacaacgtga acacggaatg
     8461 ggaacgcgtc gatggcacac ccctgccgca caatgcctac acggtgagaa atacgctggt
     8521 gattgtcttc gtggagccgc agaatctggg tcagtaccgc tgcaatggaa tcggtcgcga
     8581 tggacgtgtg gaggcccatg tggtgaggga gctggttctc ctgcccctgc ccaggatcac
     8641 cttctatccc aacatcccgc tgaccgtgga gctgggccag aacttggatg tctactgcca
     8701 ggtggagaac gtgcgtccgg aggacgtgca ttggaccacc gacaacaatc gaccactgcc
     8761 cagttccgta cgcatcgagg gcaatgtcct caggttcgcg tccatcactc aggctgctgc
     8821 cggtgaatac cgctgctcgg ccaccaatca atatggaagc cgatcgaaga acgccagggt
     8881 ggtggtgaaa cagcccagtg gcttccagcc cgttccccac tcgcaggtgc aacagcgtca
     8941 ggtgggcgac tccatccagt tgcgatgccg cctgaccacc cagtacggcg acgaggttcg
     9001 cggcaatatc cagttcaact ggtaccgtga ggacggcagc cccttgcccc gcggtgtccg
     9061 tccggatagc caggtgctgc agctggttaa attgcagccc gaggacgagg gccgctacat
     9121 ctgcaactcg tacgatttgg gcagcgggca gcaactgccc cccgtctcca tcgacttgca
     9181 agtactaaga actactaccc agtatccttt caatcggttt aagggcggtg tctccctgaa
     9241 agacacgccc tgcatggttc tgtatatttg tgcagcggta ccagcggctc cccagaaccc
     9301 catctacctg ccgccagtgg cgccaccacg ttcgcccgaa aggatcctcg agccccaact
     9361 gagcctgagt gtacaatcct cgaacctgcc agccggcgac ggcaccaccg tcgagtgctt
     9421 ctcctccgat gactcctacc cagatgtcgt gtgggaacgc gccgatggag ctccactcag
     9481 cgaaaatgtc cagcaagtgg gcaataacct ggtgattagt aacgtggcct ccaccgatgc
     9541 cggtaactat gtgtgcaagt gcaagacgga cgagggagat ctgtatacca ccagctacaa
     9601 actggaggtc gaggagcagc cccatgaact gaagagctcc aagatagtct acgccaaggt
     9661 tggcggaaat gccgacttgc agtgcggagc cgatgaagat cgacagccca gctaccgttg
     9721 gtctcgccaa tacggacaac ttcaggcggg acgcagtctg cagaatgaga aactttcgtt
     9781 ggatcgcgtt caggccaacg atgccggaac ttatgtttgt tcggcccaat acagcgatgg
     9841 cgagacggtt gacttcccca acattctggt tgtgaccggg gcgattcccc agttccgcca
     9901 ggagccccgc agctacatga gcttccccac gctctcgaac tcctcgttca agttcaactt
     9961 cgagctgacc ttccggccgg aaaacgccga cggactgctg ctcttcaatg gacagacccg
    10021 cggaagcggt gactatatcg cactctcgct gaaggatcgc tatgcggagt tccggttcga
    10081 ttttggcggt aaaccgttgc tggtgcgagc ggaggagcca ctggctttgg atgaatggca
    10141 cacggtgcgc gtgagtcgct tcaagcggga tggctacatc caggtggacg accagcatcc
    10201 ggtggccttc cccacctccc agcatcagca gataccccag ttggaactga ttgaggatct
    10261 gtacattggc ggcgtgccca actgggagtt cctgcccgcc gaggcggtgg gtcagcaatc
    10321 aggcttcgtg ggctgcatta gccggctgac cctgcaggga cgcaccgtgg agctgatccg
    10381 ggaggccaag ttcaaggagg gcatcaccga ttgccggccc tgcgcccagg gaccctgcca
    10441 gaacaagggc gtctgcctgg agagccagac ggagcaggcc tacacctgcg tctgccagcc
    10501 gggctggact ggccgggatt gtgccatcga gggcacccag tgcaccgcag gagtttgcgg
    10561 ctcgggacgc tgcgagaata cggagaacga catggagtgc ctgtgcccgc tgaacagggc
    10621 aggcgatcga tgccagtaca atgagattct aaatgaacag agcttgaatt tcaagagcaa
    10681 cagctttgcg gcctacggaa ctcccaaggt caccaaagta aacatcacac tctccgttcg
    10741 tcccgcgagc ctggaggact ctgtgatcct gtacacggcg gaatccactc tgcccagcgg
    10801 cgattacctg gctttggtcc ttcgcggtgg ccacgcggag ctgctgatca acacggccgc
    10861 ccgcttggat cccgtggtgg tgcgttcggc ggaaccgctg cccctcaatc gctggaccag
    10921 aatcgagatc aggcgtcgcc tgggcgaggg aatcctcaag gtgggcgatg gacccgagcg
    10981 aaaggccaag gcaccgggat ccgatcgcat tctgtcgctc aagacccacc tctttgtggg
    11041 cggcgtcgat cggtcgaccg taaagatcaa ccgtgatgtg aacatcacca agggcttcga
    11101 tggctgcatc tcgaagctgt acaactcgca gaaatccgtc aatctgctgg gtgacatcag
    11161 ggatgcggcg aatgtccaga actgtgggga ggcgaatgag atagatgacg atgagtatga
    11221 gatgccagta gcgctgccat cgcctaaggt cgccgagaat gaacgtcagc tgatggcgcc
    11281 gtgtgccagt gatccctgcg agaacggggg aagctgcagc gagcaggagg acatggccat
    11341 ctgctcctgt cccttcggct tcagcggcaa acactgccag aatcacctcc agctgagctt
    11401 caatgcctcg ttccgcggcg atggctacgt ggagctgaac cgcagccact tccaacccgc
    11461 cctggagcag acgtactccc acattggcat tgtgttcacc accaacaagc cgaatggcct
    11521 gcttttctgg tggggccagg aggccgggga ggagtacacc ggacaggact tcattgccgc
    11581 cgccgtggtc gatggctatg tggagtactc gatgaggctc gatggcgagg aggcggtcat
    11641 tcggaacagc gatatccgcg tggacaatgg cgagcggcac attgtgatcg ccaagcggga
    11701 tgagaacacc gccatgctgg aactcgatca gatcctggac acgggcgata cgcgacccac
    11761 catcaacaag gcaatgaagc tgccgggcaa tgtgtttgtc ggtggcgctc ctgatgtcgc
    11821 ggcattcacg ggcttccgct acaaggacaa tttcaacggc tgcattgtgg tcgtcgaggg
    11881 cgaaaccgtg ggccaaatta accttagttc agctgccatc aatggagtga atgccaacgt
    11941 gtgtcccgct aacgacgaac ctctgggagg aaccgaaccg ccagtcgtct gaggacacaa
    12001 ccagcaaccg aaattagctt tttaattaaa cattaacaaa tgaaacaaaa agaaaaacaa
    12061 tttttatata tacaacatat gaataagccc caagcaaacc tacaaaaaat tgaatattat
    12121 acgacgaaca gataatataa aaacaaaaaa agagagaaac gatcacttct actacaattg
    12181 cttcttcgat ccttaagtct aggttaaaga ttgtagcaag aaaacaagcg aatatcacaa
    12241 acatttattt aacaagaacg ccatgcgaga agtgaaacga aacagaaaca ataatgcaat
    12301 taatgcagat aatacagata aagcctagaa ccctaagaac taactaacta actcgaacaa
    12361 gaacaacaac gcatactagc caactgcaac cacaacaacc acaatagtga aggcatttta
    12421 attataattt tagtctctag cttataacta tgactacgac tcgttttttt tgtgagccca
    12481 gtgtaaaatg ttggaaatcg gaaattggcc ctacacacaa acacacacaa gttattaatt
    12541 aaataccaat tgataccata taatgataaa tgaaatacta tgaatgcaac tattgtgaac
    12601 gaacgaaaac cgttgagtgg ataaaaagca taagcagaag atatattaaa atgaaatcaa
    12661 caaca