Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii terribly reduced optic lobes


LOCUS       XM_070218429           13955 bp    mRNA    linear   INV 09-DEC-2024
            (trol), transcript variant X12, mRNA.
ACCESSION   XM_070218429
VERSION     XM_070218429.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..13955
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..13955
                     /gene="trol"
                     /note="terribly reduced optic lobes; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 7
                     Proteins"
                     /db_xref="GeneID:108055788"
     CDS             209..13282
                     /gene="trol"
                     /codon_start=1
                     /product="basement membrane-specific heparan sulfate
                     proteoglycan core protein isoform X12"
                     /protein_id="XP_070074530.1"
                     /db_xref="GeneID:108055788"
                     /translation="MGSPGSQAPAIAIGISNGRRGHTGSLLLRLLLVAFVLNACHVPP
                     TNAKQITKSKVDDQDFILADTQSLQGSVDLDDDEAFLIPPDSEEKLDKKFTPEGNWWS
                     QGLHRVRRSLNSFFGSDDDDQEKERERQRQRQNNRDAANRQKELRRQQKESQNREKQL
                     RLERQERQRLAKRNNHVVFNRVTDPRKRASDLYDENEASGLNEEETTTYRTYFVVNEP
                     YSDDYKERDSLQFQNLQKLLDEDLRNFFNRNFENNDDEEQEIHSTLERVDQTKDHFKI
                     RVQLRVDLPSSINDFGSKLEQQLNVYKRIDRLGASTDGVFTFTESSVYKYEHQYDIVT
                     PRVIVSGQPITEKPVEAPQEFDEDPIEVALPTDEVEGSGQDSGSCRGDATFQCRRSGK
                     TICDEMRCDGSRDCPDAEDEEGCEVCNELQFKCDNKCLPLNKRCDNRYDCEDQTDEAG
                     CQRYEVEESQPQPQPQPQPEPEPEPEPEPEPEPEPEPEPEEPITDNEQPEQNSECRAT
                     EFRCNNGDCIDIRKRCDHISDCSEGEDENEECPAACSGMEYQCRDGTRCISLSQQCDG
                     HSDCSDADDEEHCDGSGNDGEDCRFDEFRCGTGECIPMRQVCDNIYDCNDYSDEVSCA
                     EEEEDSVGIPIGRPPQRPAPKHDWLDELDANEYHVYHPSNVYELANSKNPCASNQFRC
                     ATTNVCIPLHLRCDNFYHCNDMSDEKDCEQYQRRTTTTTRRPSTSARPSFTFTFTTQG
                     PGLLERRNSTTSRTTAGSTTRATEAPQWPWATRPTETTTTNPITTVGVASSSPQSSCL
                     ENIEFACHNRDCIPIESVCDGTPDCGRSEDEDDALCKCTADKYKCQHGGGCIPKTQVC
                     DGKPQCRDRSDESACPRIYCPPNRLACNGRCVSRRIRCDGKRDCLDGYDEMYCPVVNT
                     TETNYHYPTHNPKPKTCRTHEWQCTNLECIEMRLKCDDVPDCSDGSDEDLSICFGTAT
                     TRLKPSDCGPDQFFCDDLCYNRSIRCNGHMDCSDGSDEIACSSLSVLPCPQHQCPSGR
                     CYSESERCDRHRHCEDGSDEANCCYADQFRCNNGDCIAESAHCDGNIDCSDQSDELDC
                     GGDSQCLPNQFRCKNGQCVSSTARCNKRSDCLDGSDEQNCANEPNNSGRGTNQLKLKT
                     YPDNQIIKESREVIFRCRDEGPNRAKVKWSRPGGRPLPPGFTDRNGRLEIPNIRVEDA
                     GAYVCEAVGYANYIPGQHVTVNLNVERLNEREIRPDSACTEYQATCMNGECIDKSGIC
                     DGHPDCSDGSDEHSCSLGLKCQPNQFMCSNSKCVDRTWRCDGENDCGDNSDETSCDPE
                     PSDAPCRYDEFQCRSGHCIPKSFQCDYMNDCTDGTDEIGCSVPSPMTLPAPSIVVMEY
                     EVLELTCVGTGVPTPTIVWRLNWGHVPEKCESKSYGGTGTLRCPNMRPQDSGAYSCEF
                     INTRGTFYPKTNSIVTVTPVRSDVCKAGFFNMLARKSEECVQCFCFGVSTNCDSANLF
                     TYAIQPPILSHRVVSVELSPFRQIVINEASPGQDLLTLHHGVQFRASNVHYNGRETPF
                     LALPAEYMGNQLKSYGGNLRYEVRYNGNGRPVSGPDVIITGNSFTLTHRVRTHPGQNN
                     RVTIPFLPGGWTKPDGRKGTREDIMMILANVDNILIRLGYLDSTAREVDLINIALDSA
                     GSADQGLGSASLVEKCTCPPGYVGDSCESCASGYVRQARGPWLGHCVPFTPEPCPAGT
                     YGNPRLGVPCQECPCPHAGANNFASGCQQSPDGDVICRCNEGYAGKRCEHCAQGYQGN
                     PLAPGGVCRKIPDSSCNVDGTYNIYSNGTCQCKDSVIGEQCDTCAPKSFHLNSFTYTG
                     CIECFCSGVGLDCDSSSWYRNQVTSTFGRTRVNHGFALISDYMRNTPVTVPVSMSTQA
                     NALSFVGSAEQAGNTLYWSLPAAFLGNKLTSYGGKLSYTLSYSPLPSGIMSRNSAPDV
                     VIKSGEDLRLIHYRKSQVSPSVANTYAVEIKESAWQRGDELVPNREHVLMALSNITAI
                     YIKATYTTSTKEASLRSVTLDTATATNLGTARAVEVEQCRCPEGYLGLSCEQCAPGYT
                     RDPEAGIYLGLCRPCECNGHSKYCNSETGECESCSDNTEGFNCDRCAAGYVGDATRGT
                     SYDCQYDDGGYPTSRPPAPGNQTAECLVNCQQEGTAGCRGYQCECKRNVAGDRCDQCR
                     PGTYGLSAQNPDGCKECYCSGLTNQCRSASLYRQLIPVDFISTPPLITDEFGDIMDRD
                     NLVPDVPRNVYTYKHTSYTPKYWSLRGSVLGNQLLSYGGRLEYSLIVESVGRDHRGKD
                     VVLIGNGLKLIWSRPDGHDNEQEYHVRLHEDEQWTVEDRGSARQATRADFMTVLSDLQ
                     HILILATPKVPTVSTSISNVILESSITTRAPGATHASDIELCQCPSGYTGTSCESCAP
                     LHYRDASGRCSQCPCDASNTESCGLVSGGNVECQCRPRWRGDRCREIDTSPIIEEPPQ
                     ICDLSRGFCCSGFQFDIAPNETISFNDTLQIYKGNRIIGNMTKLRYGCPSRETNEPTP
                     EPDTSTDDPVRTQIIVSIARPEITILPVGGSLTLSCTGRMRWTNSPVFVNWYKQGSHL
                     PEGVEVQGGNLQLFNLQISDSGIYICQAVSNETGHSFTDHVSITVSQEDQRSPAHIVD
                     LPNDVTFEEYVSNEIVCEVEGNPPPTVTWTRVDGHADAQSTRTDNNRLVFDSPRKSDE
                     GRYRCQAENSLSREEKYVVVYVRSNPPQPPPQQDRLYITPQEVNGVAGDSFQLSCQFT
                     SAASLRYDWSHDGRSLSASSPRNVVVRGNVLEVRDANVRDSGTYTCVAFDLRTRRNFT
                     ESARVYIEQPNEPGILGDKPHILTLEQNIIIVQGEDLSITCEASGTPYPSIKWTKVQE
                     NLAENVRISGNVLTIYGGRSENRGLYSCIAENSHGSDQSSTSIDIEPRERPSLTIDTA
                     TQKVSVGSQASLYCAAQGIPEPTVEWVRTDGQPLSPRHKVQAPGYVVIDDIVLDDSGT
                     YECRASNIAGQVSGLATINVQEPTLVRIEPDRQHHIVTQGDELSLSCVGSGVPTPSVF
                     WSFEGRDVDRMGVPEGAVFAQPFRTNTADVKIFRVSKENEGIYVCHGSNDAGEDQQYI
                     RVEVQPRRGDVGAGGDDNGDVDTRQPPNRPQIQPNPLSNERLTTELGNNVTLICNVDN
                     VNTEWERVDGTPLPHNAYTVRNTLVIVFVEPQNLGQYRCNGIGRDGRVEAHVVRELVL
                     LPLPRITFYPNIPLTVELGQNLDVYCQVENVRPEDVHWTTDNNRPLPSSVRIEGNVLR
                     FASITQAAAGEYRCSATNQYGSRSKNARVVVKQPSGFQPVPHSQVQQRQVGDSIQLRC
                     RLTTQYGDEVRGNIQFNWYREDGSPLPRGVRPDSQVLQLVKLQPEDEGRYICNSYDLG
                     SGQQLPPVSIDLQVLRTTTQYPFNRFKGGVSLKDTPCMVLYICAAVPAAPQNPIYLPP
                     VAPPRSPERILEPQLSLSVQSSNLPAGDGTTVECFSSDDSYPDVVWERADGAPLSENV
                     QQVGNNLVISNVASTDAGNYVCKCKTDEGDLYTTSYKLEVEEQPHELKSSKIVYAKVG
                     GNADLQCGADEDRQPSYRWSRQYGQLQAGRSLQNEKLSLDRVQANDAGTYVCSAQYSD
                     GETVDFPNILVVTGAIPQFRQEPRSYMSFPTLSNSSFKFNFELTFRPENADGLLLFNG
                     QTRGSGDYIALSLKDRYAEFRFDFGGKPLLVRAEEPLALDEWHTVRVSRFKRDGYIQV
                     DDQHPVAFPTSQHQQIPQLELIEDLYIGGVPNWEFLPAEAVGQQSGFVGCISRLTLQG
                     RTVELIREAKFKEGITDCRPCAQGPCQNKGVCLESQTEQAYTCVCQPGWTGRDCAIEG
                     TQCTAGVCGSGRCENTENDMECLCPLNRAGDRCQYNEILNEQSLNFKSNSFAAYGTPK
                     VTKVNITLSVRPASLEDSVILYTAESTLPSGDYLALVLRGGHAELLINTAARLDPVVV
                     RSAEPLPLNRWTRIEIRRRLGEGILKVGDGPERKAKAPGSDRILSLKTHLFVGGVDRS
                     TVKINRDVNITKGFDGCISKLYNSQKSVNLLGDIRDAANVQNCGEANEIDDDEYEMPV
                     ALPSPKVAENERQLMAPCASDPCENGGSCSEQEDMAICSCPFGFSGKHCQNHLQLSFN
                     ASFRGDGYVELNRSHFQPALEQTYSHIGIVFTTNKPNGLLFWWGQEAGEEYTGQDFIA
                     AAVVDGYVEYSMRLDGEEAVIRNSDIRVDNGERHIVIAKRDENTAMLELDQILDTGDT
                     RPTINKAMKLPGNVFVGGAPDVAAFTGFRYKDNFNGCIVVVEGETVGQINLSSAAING
                     VNANVCPANDEPLGGTEPPVV"
     misc_feature    458..>715
                     /gene="trol"
                     /note="Coiled-coil domain-containing protein 66; Region:
                     CCDC66; pfam15236"
                     /db_xref="CDD:434558"
     misc_feature    1460..1561
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1475..1477,1496..1498,1529..1534)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1508..1510,1517..1519,1529..1531,1547..1552)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1538..1552
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1718..1816
                     /gene="trol"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(1736..1738,1760..1762,1793..1798)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1772..1774,1781..1783,1793..1795,1811..1816)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1802..1816
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1838..1945
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1853..1855,1880..1882,1913..1918)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1892..1894,1901..1903,1913..1915,1931..1936)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1922..1936
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1973..2077
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1988..1990,2012..2014,2045..2050)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2024..2026,2033..2035,2045..2047,2063..2068)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2054..2068
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2231..2338
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2246..2248,2273..2275,2306..2311)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2285..2287,2294..2296,2306..2308,2324..2329)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2315..2329
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2597..2701
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2615..2617,2639..2641,2672..2677)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2651..2653,2660..2662,2672..2674,2690..2695)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2681..2695
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2714..2821
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2729..2731,2756..2758,2789..2794)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2768..2770,2777..2779,2789..2791,2807..2812)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2798..2812
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2834..2935
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2849..2851,2870..2872,2903..2908)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2882..2884,2891..2893,2903..2905,2921..2926)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2912..2926
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2996..3094
                     /gene="trol"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(3014..3016,3038..3040,3071..3076)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3050..3052,3059..3061,3071..3073,3089..3094)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3080..3094
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3146..3247
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3161..3163,3182..3184,3215..3220)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3194..3196,3203..3205,3215..3217,3233..3238)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3224..3238
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3275..3367
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3278..3280,3302..3304,3335..3340)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3314..3316,3323..3325,3335..3337,3353..3358)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3344..3358
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3368..3472
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3383..3385,3407..3409,3440..3445)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3419..3421,3428..3430,3440..3442,3458..3463)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3449..3463
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3488..3592
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3503..3505,3527..3529,3560..3565)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3539..3541,3548..3550,3560..3562,3578..3583)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3569..3583
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3635..3841
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    3935..4039
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3950..3952,3974..3976,4007..4012)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3986..3988,3995..3997,4007..4009,4025..4030)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4016..4030
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4055..4159
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(4070..4072,4094..4096,4127..4132)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4106..4108,4115..4117,4127..4129,4145..4150)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4136..4150
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4184..4288
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(4199..4201,4223..4225,4256..4261)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4235..4237,4244..4246,4256..4258,4274..4279)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4265..4279
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4340..4567
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    4349..4363
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    4388..4402
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    4457..4471
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    4499..4516
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    4541..4552
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    4862..5254
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    5423..5584
                     /gene="trol"
                     /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053"
                     /db_xref="CDD:395007"
     misc_feature    order(5423..5425,5429..5431,5465..5467,5495..5497,
                     5501..5503,5528..5530)
                     /gene="trol"
                     /note="EGF-like motif [active]"
                     /db_xref="CDD:238012"
     misc_feature    5957..6367
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    <6368..6448
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domain;
                     laminins are the major noncollagenous components of
                     basement membranes that mediate cell adhesion, growth
                     migration, and differentiation; the laminin-type epidermal
                     growth factor-like module occurs in...; Region: EGF_Lam;
                     cd00055"
                     /db_xref="CDD:238012"
     misc_feature    6470..6619
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domain;
                     laminins are the major noncollagenous components of
                     basement membranes that mediate cell adhesion, growth
                     migration, and differentiation; the laminin-type epidermal
                     growth factor-like module occurs in...; Region: EGF_Lam;
                     cd00055"
                     /db_xref="CDD:238012"
     misc_feature    order(6473..6475,6479..6481,6500..6502,6521..6523,
                     6530..6532,6557..6559)
                     /gene="trol"
                     /note="EGF-like motif [active]"
                     /db_xref="CDD:238012"
     misc_feature    <6728..6820
                     /gene="trol"
                     /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053"
                     /db_xref="CDD:395007"
     misc_feature    7016..7420
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    7883..8131
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    7916..7930
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    7964..7978
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    8021..8035
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    8063..8080
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    8108..8119
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    <8210..8371
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    8462..8713
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    8495..8509
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    8534..8548
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    8603..8617
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    8645..8662
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    8750..8992
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    8801..8815
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409570"
     misc_feature    8840..8854
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409570"
     misc_feature    8897..8911
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409570"
     misc_feature    8939..8956
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409570"
     misc_feature    8978..8989
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409570"
     misc_feature    9044..9274
                     /gene="trol"
                     /note="Immunoglobulin I-set domain; Region: I-set;
                     pfam07679"
                     /db_xref="CDD:400151"
     misc_feature    9068..9082
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    9107..9121
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    9170..9184
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    9212..9229
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    9251..9262
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    9311..9574
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    9341..9355
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    9380..9394
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    9512..9529
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    9947..10177
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    9974..9988
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    10013..10027
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    10073..10087
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    10115..10132
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    10211..>10414
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    10244..10258
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    10292..10315
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    10361..10375
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    10661..10867
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    10733..10747
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    10796..10807
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    10835..10852
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    10937..11137
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    10961..10975
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    11000..11014
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    11057..11071
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    11099..11116
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    11201..11644
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     misc_feature    11711..11809
                     /gene="trol"
                     /note="EGF-like domain; Region: EGF; pfam00008"
                     /db_xref="CDD:394967"
     misc_feature    11951..12412
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     misc_feature    12572..12670
                     /gene="trol"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    12695..13156
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     polyA_site      13955
                     /gene="trol"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attaggttgc gcgccatcgt tccaggcggt cgcacattcc acgtgccata gccgtaacaa
       61 caacctgcca accgcttaaa accaaactca aatacgaacc gaaactgcct tcacacacac
      121 aagtacctaa accaaatcta aatagctgcc aaaagaaacc aaaaattcca gagacgtcgt
      181 agcatccgtt ccccggaaga agaagaagat gggatcgccg ggatcccaag cgcccgcgat
      241 cgcgatcggg atcagtaacg ggcggagagg tcacacgggg tcgctgctcc tgcgcctcct
      301 tctcgtggcc ttcgtcctca acgcctgcca cgtacccccg accaatgcca agcaaattac
      361 gaaaagtaaa gttgatgacc aggactttat actggccgac acacaatcgc tgcagggcag
      421 cgttgacctt gacgatgacg aagcgttcct gattcctccg gattccgaag agaagttgga
      481 taagaagttc acgccggagg gcaactggtg gagccagggg ctccatcgtg ttcgccgctc
      541 cctaaatagc ttcttcggct ccgacgacga tgatcaggaa aaggaacgtg agcgtcagag
      601 gcaaaggcaa aataatcgcg atgccgccaa ccggcaaaag gaacttcggc gccagcaaaa
      661 ggagagccag aaccgcgaga agcagctgcg attggagcgc caggagaggc agcgccttgc
      721 caagcggaac aatcacgtgg tcttcaatcg cgtcaccgat ccccgcaagc gggcatccga
      781 cctttacgac gagaacgagg catctggcct aaacgaggag gaaaccacca cctatcgcac
      841 ctactttgtt gttaatgagc catattcaga cgactacaag gagcgggaca gcctccagtt
      901 ccagaatctg caaaaacttc ttgacgagga cctgcgcaac ttcttcaatc gcaatttcga
      961 aaataacgat gatgaagagc aggaaatcca tagcacccta gagcgagtcg atcaaaccaa
     1021 ggaccatttt aaaattcgcg tgcaacttag ggtagatctg cccagttcaa tcaacgactt
     1081 tggaagtaag ttggagcaac aactgaatgt ctacaagcga atcgatcgtt tgggtgccag
     1141 taccgatggc gtcttcacct ttaccgaatc gagcgtctac aaatacgaac accaatacga
     1201 tattgtgaca ccgagagtaa ttgtatctgg acaaccgata actgaaaaac cagtcgaagc
     1261 accccaagaa ttcgatgagg atcctatcga agttgcattg cccacggatg aggtggaggg
     1321 ctccggccaa gattccggta gctgtcgcgg cgatgccacc ttccagtgtc gaaggagtgg
     1381 aaagactatt tgcgatgaaa tgcgatgcga tggatctcgc gattgtcccg atgccgagga
     1441 cgaggaaggc tgcgaggttt gcaacgaact tcagttcaag tgcgataaca agtgtctgcc
     1501 gctcaataag cgctgcgata atcgatacga ttgtgaggat cagacggacg aggctggttg
     1561 tcaacggtac gaagtagaag agtctcagcc tcagccgcag ccgcaacctc agcctgaacc
     1621 ggaacctgaa cctgaacctg agcctgagcc tgaacctgaa ccagaaccag aacctgaaga
     1681 gcctataaca gacaatgaac agcctgagca aaactcagaa tgccgggcca ccgagttcag
     1741 atgcaacaat ggggactgca tcgatattag aaagcgttgc gatcacattt cggactgtag
     1801 cgaaggcgag gacgagaacg aggagtgccc cgccgcctgc agcggaatgg agtatcaatg
     1861 tcgcgacggc acgcgctgca taagtttgag tcagcagtgc gacggtcatt ccgattgcag
     1921 cgacgccgac gacgaggagc attgcgacgg aagtggtaac gatggtgagg attgtcggtt
     1981 cgatgagttc cgttgcggaa ctggtgagtg cataccgatg cgtcaggtgt gcgataacat
     2041 ctacgattgc aacgattatt ccgatgaggt cagctgcgcc gaggaggagg aagatagtgt
     2101 gggcataccc attggccgtc caccgcagag gccagcgccc aaacacgact ggctggacga
     2161 attggacgcc aatgagtacc acgtctatca tccaagtaat gtctatgagt tggccaattc
     2221 caagaatccc tgtgccagca atcaatttcg ctgcgccacc acgaatgtgt gcatccccct
     2281 gcatttgcgt tgcgataatt tctatcactg caacgatatg agcgatgaga aggactgcga
     2341 gcagtatcaa cgacgcacca ccaccaccac ccgacgacct tcgacctcgg cccggccctc
     2401 cttcaccttc accttcacga cccaggggcc aggcttgctg gagcgtcgca atagcaccac
     2461 cagtagaacc accgcaggca gcaccaccag agccaccgaa gcaccacaat ggccatgggc
     2521 aaccagaccc accgagacca cgaccactaa cccaataaca acagttggcg tagcgagcag
     2581 ctcacctcag tcctcctgtc tcgaaaacat cgaattcgcg tgtcacaatc gcgattgcat
     2641 tccgattgag agcgtctgcg atggcacccc cgactgcgga cgcagtgaag acgaggacga
     2701 cgctctttgc aagtgcaccg ccgacaagta caaatgccaa cacggcggag gctgcattcc
     2761 gaaaacccag gtgtgcgatg gcaaacctca gtgccgcgac cgcagcgacg agagcgcctg
     2821 ccccaggata tattgtccac ctaataggct ggcctgcaac ggccgatgcg tcagtcggag
     2881 aattaggtgt gatggcaaac gcgattgcct cgatggctac gacgagatgt attgtccggt
     2941 agtcaacacc acagagacca actaccatta tcccacacac aatcctaaac caaaaacctg
     3001 ccgaacccac gagtggcagt gtacgaatct cgagtgcatc gagatgagat tgaagtgcga
     3061 tgatgttccg gattgctcgg atggatccga tgaggacctc agcatttgct tcggcacggc
     3121 caccacacga ctaaagccca gcgactgcgg tccggatcag ttcttctgcg atgatttatg
     3181 ctataatcgc tctattcgat gcaatggcca tatggattgc tcagatggca gtgatgagat
     3241 cgcttgtagc tcgctgtcag tgcttccatg tccacagcac cagtgtccca gtggcaggtg
     3301 ttattcggaa agtgagcgat gcgatcgcca caggcactgc gaggatggct ccgatgaggc
     3361 caactgctgt tacgcggatc aattccgctg caataatggt gactgcattg cggaatcggc
     3421 tcattgcgat ggaaatatcg attgtagcga ccagtccgat gaactcgact gcggaggaga
     3481 ctcgcagtgt ctgcccaacc aattccgctg caagaatggc caatgtgtga gctctacagc
     3541 gcgttgcaac aagcgttccg attgtttgga tggctccgat gagcagaatt gtgccaatga
     3601 acctaacaac tccggacgtg gaacgaacca attgaaactc aagacctatc ccgacaacca
     3661 aatcattaag gagagtcgtg aggtcatctt ccgttgccgt gacgaaggtc ccaaccgcgc
     3721 caaggtcaag tggtcgcgac ccggcggacg tcccctgccc cccggtttca ccgatcgcaa
     3781 tggccgcctg gagatcccca acatcagggt ggaggatgct ggcgcctatg tctgcgaggc
     3841 cgtgggctat gccaactata ttcccggtca gcacgtcacc gtaaacctca acgtcgagcg
     3901 cttaaacgaa cgcgaaatcc gtccggactc agcctgtacg gagtaccagg ccacctgcat
     3961 gaacggcgag tgtatcgata agtcgggcat ctgcgatgga catccggact gttcggatgg
     4021 ctccgatgag cacagctgca gtttgggttt gaagtgtcag cccaaccagt tcatgtgctc
     4081 caattccaag tgtgtggatc gcacctggcg ctgtgatggc gagaacgact gcggcgataa
     4141 ctccgatgag acctcttgcg atccggaacc aagtgatgct ccgtgccgat acgacgaatt
     4201 ccagtgccgc agcggtcatt gcattcccaa gagcttccag tgcgactata tgaacgattg
     4261 taccgatggt accgatgaaa ttggatgctc ggtgccctct ccaatgaccc tacccgcacc
     4321 ctcgattgtc gtgatggagt acgaggtcct cgagctgacc tgcgtgggca ccggcgtccc
     4381 gacgccgacg atcgtgtggc gtctcaactg gggccatgtg cccgagaagt gtgaatcgaa
     4441 gagctacggc ggaaccggaa ccctgcgctg tccgaacatg aggccccagg acagtggtgc
     4501 ctactcgtgc gagttcatca acacacgcgg caccttctat ccgaaaacga actcgattgt
     4561 caccgttacg ccggtgcgct cggatgtctg caaggccgga ttcttcaata tgctggcccg
     4621 caagtcggag gaatgcgtcc agtgcttctg ctttggcgtt tcgaccaact gtgacagtgc
     4681 caatttgttc acctacgcca ttcagccacc gatcctttcg caccgcgtgg tcagcgttga
     4741 actcagtccg ttccgtcaaa ttgtcatcaa tgaggctagt ccgggtcagg atctgctcac
     4801 cttgcaccat ggtgttcagt tcagggcatc gaacgtacac tacaacggcc gggagacacc
     4861 attcttggcc ctgcccgctg agtatatggg caaccagctg aagtcctatg gcggcaatct
     4921 gcgctacgag gtcaggtaca atggcaacgg tagaccggtc agcggacccg atgtcatcat
     4981 caccggcaac agtttcacgc taacccatcg cgttcgcact catccgggtc agaacaacag
     5041 ggtgactatt cccttcctgc cgggaggctg gacgaagccg gatggtcgca agggaacgcg
     5101 agaggacatc atgatgatac tggccaatgt ggacaatatt ctgattcgac tgggctacct
     5161 ggatagcaca gctcgcgaag tggatctgat aaatatcgcc ttggattcgg ccggaagtgc
     5221 cgatcaggga ttgggcagtg cctcgctcgt ggagaagtgc acctgtccgc ccggctatgt
     5281 tggtgattcg tgcgagtcct gtgcctcggg ctatgttcgc caggcccgcg gaccttggct
     5341 gggtcattgt gtgcccttca ccccggaacc gtgcccagcg ggaacctacg gcaatccccg
     5401 acttggtgtt ccctgccagg agtgtccgtg cccccacgcg ggcgccaata actttgccag
     5461 cggctgccaa cagagtcccg atggcgatgt gatttgccgc tgcaacgaag gctatgccgg
     5521 caagaggtgc gagcactgcg cccagggtta ccagggtaat ccgttggcac cgggaggagt
     5581 ctgtcgcaag atacccgata gttcgtgcaa tgtcgacggc acctacaaca tctacagcaa
     5641 tggaacgtgc cagtgcaagg atagcgtgat tggcgaacag tgcgacacct gcgcgccgaa
     5701 gagtttccac ctcaattcgt tcacctacac cggttgcatc gagtgcttct gcagtggagt
     5761 gggcttggat tgtgacagta gttcgtggta tcgcaaccag gtcaccagca cctttggacg
     5821 aacgcgcgtc aatcatggat tcgccctgat tagcgactat atgcgcaata ccccggtaac
     5881 ggtgcccgtt tccatgtcca cccaggccaa tgccttgagc ttcgtgggat ccgccgagca
     5941 ggccggtaat acgctctact ggagtcttcc cgccgccttc ctgggcaaca agctgacctc
     6001 gtacggaggc aagttgagct acacgctcag ctacagtccc ctgcccagcg gcattatgtc
     6061 gcgcaacagt gcccccgatg tggtgatcaa gagcggcgag gatctgaggc tcatccatta
     6121 caggaagtcg caggtcagtc ccagtgtggc caacacctat gccgtggaga tcaaggagag
     6181 cgcatggcag cgcggcgatg aactggtgcc taaccgtgaa cacgtcctga tggccctcag
     6241 caatattacg gccatctata tcaaggccac gtacacgact agcaccaagg aggcctcgct
     6301 gcgatcggtc acattggata cggccacggc caccaatctg ggcaccgcac gtgccgtcga
     6361 agtggagcag tgccgctgtc ccgagggcta tttgggtctc tcctgcgagc agtgtgctcc
     6421 tggctatacg cgcgatccgg aggcaggaat ctatctgggt ctctgcaggc cctgcgagtg
     6481 caatggacat tccaagtatt gcaacagtga gacaggcgaa tgcgaaagct gttccgacaa
     6541 caccgaagga ttcaattgtg accgatgcgc cgccggctat gtgggtgatg ccacccgagg
     6601 aacttcgtac gactgtcaat acgatgacgg cggctatccg acgtcgcgtc caccggcacc
     6661 gggcaatcag acggccgaat gcctggtgaa ttgccaacag gagggaaccg ccggttgccg
     6721 cggctaccag tgcgagtgca agaggaatgt ggctggcgat cgatgcgatc agtgccgccc
     6781 cggaacctat ggactgtcgg cccaaaatcc ggacggttgc aaggagtgct actgctccgg
     6841 actgaccaac cagtgccgct cggcgtctct ctaccgccag ctgatacccg tggacttcat
     6901 ttcgacgcca ccattgataa cagacgaatt cggcgacatc atggataggg ataaccttgt
     6961 gcccgacgtg cccaggaatg tgtataccta caagcacacc tcctacacgc ccaagtactg
     7021 gagcctgagg ggtagtgtgc tgggcaacca gctgttgtcg tacggcggcc gcttggagta
     7081 cagcctgatt gtggagtccg ttggccggga ccatcgtggc aaggatgtgg tcctaattgg
     7141 caacggactc aagctgatct ggtcgcgacc cgatggccat gacaacgagc aggaatacca
     7201 tgtgcgtttg catgaggacg agcagtggac ggttgaggat cgtggatcgg cacgacaggc
     7261 cacgcgggcc gacttcatga ctgtgctgtc ggatctgcag cacatcctga tcctggccac
     7321 acccaaggtg cccacggtca gcacctcgat tagcaatgtc atcctggaga gttcgataac
     7381 cacgagagcg cctggagcta cgcatgcctc cgatatcgag ttgtgccagt gtccatccgg
     7441 ttatacgggc acttcctgtg agtcctgcgc accactgcac taccgcgacg cctctggacg
     7501 ctgcagtcag tgtccttgcg acgcttccaa cacggaatcc tgcggcttgg tcagcggcgg
     7561 taacgtcgaa tgccagtgca ggccacgctg gaggggtgat cgctgccggg aaattgacac
     7621 atcgcccatt atcgaagaac cgccccagat atgtgattta agcaggggat tctgttgcag
     7681 cggctttcag ttcgatatcg caccgaacga gacaatctcg tttaatgaca ccctgcagat
     7741 atataagggc aacagaatca taggaaatat gaccaagctg cgctacggct gtccatcgcg
     7801 agaaactaac gaaccgactc cggaaccgga taccagtacc gatgatcccg tgcgcaccca
     7861 gatcatagtg tcgattgcca ggccagagat taccattctg cccgtgggtg gatcgctgac
     7921 cctcagctgt accggtcgaa tgcgctggac caatagccca gtgtttgtga actggtacaa
     7981 gcagggcagt cacctgcccg agggagtcga ggtgcaaggc ggtaatctgc agctgttcaa
     8041 cctgcagatc agcgattctg gaatctacat ctgccaggcc gtaagcaacg agaccggcca
     8101 cagctttacg gaccacgtct ccatcaccgt ttcccaggag gaccaacgct cgccggctca
     8161 cattgtggat ttgcccaacg acgtgacctt cgaggagtac gtaagcaatg agatcgtctg
     8221 cgaggtggag ggcaacccac cacccactgt cacctggact cgcgtggatg gccatgcgga
     8281 cgcccaaagt acgcgaacgg acaacaatcg gctggtcttc gattcgccga ggaaatcgga
     8341 cgagggtcgc tatcgctgcc aggcagagaa tagcctgagt cgggaggaga agtacgtagt
     8401 cgtgtatgtc cggagcaatc ctccccagcc gccgccgcag caggatcgtt tgtacatcac
     8461 accgcaggag gtgaacggtg tggccggtga ctccttccag ttgtcctgcc aattcaccag
     8521 cgctgcctct ctgcgctacg attggtccca cgatggtcgc tccctgtccg cgtcgtcacc
     8581 ccgaaatgtt gtggtccgcg gaaatgtcct ggaagtccgc gatgccaacg ttcgcgactc
     8641 cggcacctac acctgtgtgg ccttcgacct gcgcacccga cgcaacttca ccgagagcgc
     8701 acgggtctac atcgagcagc ccaacgagcc gggaatcctt ggcgacaagc cgcatatctt
     8761 gaccttggag cagaacatca taattgtgca aggcgaggac ttgagcatca catgtgaggc
     8821 aagtggaacg ccctatccct cgattaagtg gaccaaggtg caggagaatc tggccgaaaa
     8881 tgtccgcatc agtggcaatg tgctcaccat ctacggaggc cgcagtgaga atcgtggtct
     8941 ttactcctgc atcgccgaga actctcacgg cagcgatcag tccagcacaa gcatcgatat
     9001 tgaaccccgg gagcggccga gtcttacgat tgatacggcc acccaaaagg tttcggttgg
     9061 ctcccaggcg tccctttact gtgccgccca gggcattccc gaaccgaccg tcgagtgggt
     9121 tcgaacggat ggtcagccac tgtcgccgcg tcacaaggtc caggcacccg gctatgttgt
     9181 gatcgatgac attgtgctcg atgatagcgg tacctacgag tgccgggcga gcaacatagc
     9241 tggccaggtg agcggcttgg ccaccattaa cgtccaggag ccaactcttg tgcggatcga
     9301 accagatagg caacaccata tcgtcaccca gggcgacgaa ctctcgctca gctgcgtggg
     9361 cagtggcgtc cctactcctt cggtcttttg gagtttcgag ggaagagacg ttgacaggat
     9421 gggagtaccg gaaggtgctg tttttgcgca acctttccga accaacactg ccgacgtgaa
     9481 aatcttccgg gtgagcaagg agaacgaagg catctacgtc tgtcacggat ccaatgacgc
     9541 gggtgaagat caacaataca ttcgcgtgga ggtacaaccc agacggggtg acgtcggtgc
     9601 aggaggagat gacaatggtg atgtcgatac ccgacagccc cccaatcggc cccaaatcca
     9661 accgaatcca ttgagcaacg aacgcctgac caccgaattg ggcaacaatg tgaccctcat
     9721 ctgcaacgtg gacaacgtga acacggaatg ggaacgcgtc gatggcacac ccctgccgca
     9781 caatgcctac acggtgagaa atacgctggt gattgtcttc gtggagccgc agaatctggg
     9841 tcagtaccgc tgcaatggaa tcggtcgcga tggacgtgtg gaggcccatg tggtgaggga
     9901 gctggttctc ctgcccctgc ccaggatcac cttctatccc aacatcccgc tgaccgtgga
     9961 gctgggccag aacttggatg tctactgcca ggtggagaac gtgcgtccgg aggacgtgca
    10021 ttggaccacc gacaacaatc gaccactgcc cagttccgta cgcatcgagg gcaatgtcct
    10081 caggttcgcg tccatcactc aggctgctgc cggtgaatac cgctgctcgg ccaccaatca
    10141 atatggaagc cgatcgaaga acgccagggt ggtggtgaaa cagcccagtg gcttccagcc
    10201 cgttccccac tcgcaggtgc aacagcgtca ggtgggcgac tccatccagt tgcgatgccg
    10261 cctgaccacc cagtacggcg acgaggttcg cggcaatatc cagttcaact ggtaccgtga
    10321 ggacggcagc cccttgcccc gcggtgtccg tccggatagc caggtgctgc agctggttaa
    10381 attgcagccc gaggacgagg gccgctacat ctgcaactcg tacgatttgg gcagcgggca
    10441 gcaactgccc cccgtctcca tcgacttgca agtactaaga actactaccc agtatccttt
    10501 caatcggttt aagggcggtg tctccctgaa agacacgccc tgcatggttc tgtatatttg
    10561 tgcagcggta ccagcggctc cccagaaccc catctacctg ccgccagtgg cgccaccacg
    10621 ttcgcccgaa aggatcctcg agccccaact gagcctgagt gtacaatcct cgaacctgcc
    10681 agccggcgac ggcaccaccg tcgagtgctt ctcctccgat gactcctacc cagatgtcgt
    10741 gtgggaacgc gccgatggag ctccactcag cgaaaatgtc cagcaagtgg gcaataacct
    10801 ggtgattagt aacgtggcct ccaccgatgc cggtaactat gtgtgcaagt gcaagacgga
    10861 cgagggagat ctgtatacca ccagctacaa actggaggtc gaggagcagc cccatgaact
    10921 gaagagctcc aagatagtct acgccaaggt tggcggaaat gccgacttgc agtgcggagc
    10981 cgatgaagat cgacagccca gctaccgttg gtctcgccaa tacggacaac ttcaggcggg
    11041 acgcagtctg cagaatgaga aactttcgtt ggatcgcgtt caggccaacg atgccggaac
    11101 ttatgtttgt tcggcccaat acagcgatgg cgagacggtt gacttcccca acattctggt
    11161 tgtgaccggg gcgattcccc agttccgcca ggagccccgc agctacatga gcttccccac
    11221 gctctcgaac tcctcgttca agttcaactt cgagctgacc ttccggccgg aaaacgccga
    11281 cggactgctg ctcttcaatg gacagacccg cggaagcggt gactatatcg cactctcgct
    11341 gaaggatcgc tatgcggagt tccggttcga ttttggcggt aaaccgttgc tggtgcgagc
    11401 ggaggagcca ctggctttgg atgaatggca cacggtgcgc gtgagtcgct tcaagcggga
    11461 tggctacatc caggtggacg accagcatcc ggtggccttc cccacctccc agcatcagca
    11521 gataccccag ttggaactga ttgaggatct gtacattggc ggcgtgccca actgggagtt
    11581 cctgcccgcc gaggcggtgg gtcagcaatc aggcttcgtg ggctgcatta gccggctgac
    11641 cctgcaggga cgcaccgtgg agctgatccg ggaggccaag ttcaaggagg gcatcaccga
    11701 ttgccggccc tgcgcccagg gaccctgcca gaacaagggc gtctgcctgg agagccagac
    11761 ggagcaggcc tacacctgcg tctgccagcc gggctggact ggccgggatt gtgccatcga
    11821 gggcacccag tgcaccgcag gagtttgcgg ctcgggacgc tgcgagaata cggagaacga
    11881 catggagtgc ctgtgcccgc tgaacagggc aggcgatcga tgccagtaca atgagattct
    11941 aaatgaacag agcttgaatt tcaagagcaa cagctttgcg gcctacggaa ctcccaaggt
    12001 caccaaagta aacatcacac tctccgttcg tcccgcgagc ctggaggact ctgtgatcct
    12061 gtacacggcg gaatccactc tgcccagcgg cgattacctg gctttggtcc ttcgcggtgg
    12121 ccacgcggag ctgctgatca acacggccgc ccgcttggat cccgtggtgg tgcgttcggc
    12181 ggaaccgctg cccctcaatc gctggaccag aatcgagatc aggcgtcgcc tgggcgaggg
    12241 aatcctcaag gtgggcgatg gacccgagcg aaaggccaag gcaccgggat ccgatcgcat
    12301 tctgtcgctc aagacccacc tctttgtggg cggcgtcgat cggtcgaccg taaagatcaa
    12361 ccgtgatgtg aacatcacca agggcttcga tggctgcatc tcgaagctgt acaactcgca
    12421 gaaatccgtc aatctgctgg gtgacatcag ggatgcggcg aatgtccaga actgtgggga
    12481 ggcgaatgag atagatgacg atgagtatga gatgccagta gcgctgccat cgcctaaggt
    12541 cgccgagaat gaacgtcagc tgatggcgcc gtgtgccagt gatccctgcg agaacggggg
    12601 aagctgcagc gagcaggagg acatggccat ctgctcctgt cccttcggct tcagcggcaa
    12661 acactgccag aatcacctcc agctgagctt caatgcctcg ttccgcggcg atggctacgt
    12721 ggagctgaac cgcagccact tccaacccgc cctggagcag acgtactccc acattggcat
    12781 tgtgttcacc accaacaagc cgaatggcct gcttttctgg tggggccagg aggccgggga
    12841 ggagtacacc ggacaggact tcattgccgc cgccgtggtc gatggctatg tggagtactc
    12901 gatgaggctc gatggcgagg aggcggtcat tcggaacagc gatatccgcg tggacaatgg
    12961 cgagcggcac attgtgatcg ccaagcggga tgagaacacc gccatgctgg aactcgatca
    13021 gatcctggac acgggcgata cgcgacccac catcaacaag gcaatgaagc tgccgggcaa
    13081 tgtgtttgtc ggtggcgctc ctgatgtcgc ggcattcacg ggcttccgct acaaggacaa
    13141 tttcaacggc tgcattgtgg tcgtcgaggg cgaaaccgtg ggccaaatta accttagttc
    13201 agctgccatc aatggagtga atgccaacgt gtgtcccgct aacgacgaac ctctgggagg
    13261 aaccgaaccg ccagtcgtct gaggacacaa ccagcaaccg aaattagctt tttaattaaa
    13321 cattaacaaa tgaaacaaaa agaaaaacaa tttttatata tacaacatat gaataagccc
    13381 caagcaaacc tacaaaaaat tgaatattat acgacgaaca gataatataa aaacaaaaaa
    13441 agagagaaac gatcacttct actacaattg cttcttcgat ccttaagtct aggttaaaga
    13501 ttgtagcaag aaaacaagcg aatatcacaa acatttattt aacaagaacg ccatgcgaga
    13561 agtgaaacga aacagaaaca ataatgcaat taatgcagat aatacagata aagcctagaa
    13621 ccctaagaac taactaacta actcgaacaa gaacaacaac gcatactagc caactgcaac
    13681 cacaacaacc acaatagtga aggcatttta attataattt tagtctctag cttataacta
    13741 tgactacgac tcgttttttt tgtgagccca gtgtaaaatg ttggaaatcg gaaattggcc
    13801 ctacacacaa acacacacaa gttattaatt aaataccaat tgataccata taatgataaa
    13861 tgaaatacta tgaatgcaac tattgtgaac gaacgaaaac cgttgagtgg ataaaaagca
    13921 taagcagaag atatattaaa atgaaatcaa caaca