Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii terribly reduced optic lobes


LOCUS       XM_070218426           14129 bp    mRNA    linear   INV 09-DEC-2024
            (trol), transcript variant X9, mRNA.
ACCESSION   XM_070218426
VERSION     XM_070218426.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..14129
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..14129
                     /gene="trol"
                     /note="terribly reduced optic lobes; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 8
                     Proteins"
                     /db_xref="GeneID:108055788"
     CDS             209..13456
                     /gene="trol"
                     /codon_start=1
                     /product="basement membrane-specific heparan sulfate
                     proteoglycan core protein isoform X9"
                     /protein_id="XP_070074527.1"
                     /db_xref="GeneID:108055788"
                     /translation="MGSPGSQAPAIAIGISNGRRGHTGSLLLRLLLVAFVLNACHVPP
                     TNAKQITKSKVDDQDFILADTQSLQGSVDLDDDEAFLIPPDSEEKLDKKFTPEGNWWS
                     QGLHRVRRSLNSFFGSDDDDQEKERERQRQRQNNRDAANRQKELRRQQKESQNREKQL
                     RLERQERQRLAKRNNHVVFNRVTDPRKRASDLYDENEASGLNEEETTTYRTYFVVNEP
                     YSDDYKERDSLQFQNLQKLLDEDLRNFFNRNFENNDDEEQEIHSTLERVDQTKDHFKI
                     RVQLRVDLPSSINDFGSKLEQQLNVYKRIDRLGASTDGVFTFTESSVYKYEHQYDIVT
                     PRVIVSGQPITEKPVEAPQEFDEDPIEVALPTDEVEGSGQDSGSCRGDATFQCRRSGK
                     TICDEMRCDGSRDCPDAEDEEGCEVCNELQFKCDNKCLPLNKRCDNRYDCEDQTDEAG
                     CQRYEVEESQPQPQPQPQPEPEPEPEPEPEPEPEPEPEPEEPITDNEQPEQNSECRAT
                     EFRCNNGDCIDIRKRCDHISDCSEGEDENEECPAACSGMEYQCRDGTRCISLSQQCDG
                     HSDCSDADDEEHCDGSGNDGEDCRFDEFRCGTGECIPMRQVCDNIYDCNDYSDEVSCA
                     EEEEDSVGIPIGRPPQRPAPKHDWLDELDANEYHVYHPSNVYELANSKNPCASNQFRC
                     ATTNVCIPLHLRCDNFYHCNDMSDEKDCEQYQRRTTTTTRRPSTSARPSFTFTFTTQG
                     PGLLERRNSTTSRTTAGSTTRATEAPQWPWATRPTETTTTNPITTVGVANLNGRLNKT
                     RLGVQCQENQYQCGDGSCISGYKRCNGINDCADDADEYNCIYTYNEDYVDPDDNPLNE
                     CDILEFECDYSLCLPLEKKCDGYADCEDLSDEFECQSYTENCLLSEFECDGYCLPRDQ
                     LCNGIINCQDGSDERNCTFCREDAYLCTTGECVAVNQRCNGIVECADGSDERHCVVNT
                     TETNYHYPTHNPKPKTCRTHEWQCTNLECIEMRLKCDDVPDCSDGSDEDLSICFGTAT
                     TRLKPSDCGPDQFFCDDLCYNRSIRCNGHMDCSDGSDEIACSSLSVLPCPQHQCPSGR
                     CYSESERCDRHRHCEDGSDEANCCYADQFRCNNGDCIAESAHCDGNIDCSDQSDELDC
                     GGDSQCLPNQFRCKNGQCVSSTARCNKRSDCLDGSDEQNCANEPNNSGRGTNQLKLKT
                     YPDNQIIKESREVIFRCRDEGPNRAKVKWSRPGGRPLPPGFTDRNGRLEIPNIRVEDA
                     GAYVCEAVGYANYIPGQHVTVNLNVERLNEREIRPDSACTEYQATCMNGECIDKSGIC
                     DGHPDCSDGSDEHSCSLGLKCQPNQFMCSNSKCVDRTWRCDGENDCGDNSDETSCDPE
                     PSDAPCRYDEFQCRSGHCIPKSFQCDYMNDCTDGTDEIGCSVPSPMTLPAPSIVVMEY
                     EVLELTCVGTGVPTPTIVWRLNWGHVPEKCESKSYGGTGTLRCPNMRPQDSGAYSCEF
                     INTRGTFYPKTNSIVTVTPVRSDVCKAGFFNMLARKSEECVQCFCFGVSTNCDSANLF
                     TYAIQPPILSHRVVSVELSPFRQIVINEASPGQDLLTLHHGVQFRASNVHYNGRETPF
                     LALPAEYMGNQLKSYGGNLRYEVRYNGNGRPVSGPDVIITGNSFTLTHRVRTHPGQNN
                     RVTIPFLPGGWTKPDGRKGTREDIMMILANVDNILIRLGYLDSTAREVDLINIALDSA
                     GSADQGLGSASLVEKCTCPPGYVGDSCESCASGYVRQARGPWLGHCVPFTPEPCPAGT
                     YGNPRLGVPCQECPCPHAGANNFASGCQQSPDGDVICRCNEGYAGKRCEHCAQGYQGN
                     PLAPGGVCRKIPDSSCNVDGTYNIYSNGTCQCKDSVIGEQCDTCAPKSFHLNSFTYTG
                     CIECFCSGVGLDCDSSSWYRNQVTSTFGRTRVNHGFALISDYMRNTPVTVPVSMSTQA
                     NALSFVGSAEQAGNTLYWSLPAAFLGNKLTSYGGKLSYTLSYSPLPSGIMSRNSAPDV
                     VIKSGEDLRLIHYRKSQVSPSVANTYAVEIKESAWQRGDELVPNREHVLMALSNITAI
                     YIKATYTTSTKEASLRSVTLDTATATNLGTARAVEVEQCRCPEGYLGLSCEQCAPGYT
                     RDPEAGIYLGLCRPCECNGHSKYCNSETGECESCSDNTEGFNCDRCAAGYVGDATRGT
                     SYDCQYDDGGYPTSRPPAPGNQTAECLVNCQQEGTAGCRGYQCECKRNVAGDRCDQCR
                     PGTYGLSAQNPDGCKECYCSGLTNQCRSASLYRQLIPVDFISTPPLITDEFGDIMDRD
                     NLVPDVPRNVYTYKHTSYTPKYWSLRGSVLGNQLLSYGGRLEYSLIVESVGRDHRGKD
                     VVLIGNGLKLIWSRPDGHDNEQEYHVRLHEDEQWTVEDRGSARQATRADFMTVLSDLQ
                     HILILATPKVPTVSTSISNVILESSITTRAPGATHASDIELCQCPSGYTGTSCESCAP
                     LHYRDASGRCSQCPCDASNTESCGLVSGGNVECQCRPRWRGDRCREIDTSPIIEEPPQ
                     ICDLSRGFCCSGFQFDIAPNETISFNDTLQIYKGNRIIGNMTKLRYGCPSRETNEPTP
                     EPDTSTDDPVRTQIIVSIARPEITILPVGGSLTLSCTGRMRWTNSPVFVNWYKQGSHL
                     PEGVEVQGGNLQLFNLQISDSGIYICQAVSNETGHSFTDHVSITVSQEDQRSPAHIVD
                     LPNDVTFEEYVSNEIVCEVEGNPPPTVTWTRVDGHADAQSTRTDNNRLVFDSPRKSDE
                     GRYRCQAENSLSREEKYVVVYVRSNPPQPPPQQDRLYITPQEVNGVAGDSFQLSCQFT
                     SAASLRYDWSHDGRSLSASSPRNVVVRGNVLEVRDANVRDSGTYTCVAFDLRTRRNFT
                     ESARVYIEQPNEPGILGDKPHILTLEQNIIIVQGEDLSITCEASGTPYPSIKWTKVQE
                     NLAENVRISGNVLTIYGGRSENRGLYSCIAENSHGSDQSSTSIDIEPRERPSLTIDTA
                     TQKVSVGSQASLYCAAQGIPEPTVEWVRTDGQPLSPRHKVQAPGYVVIDDIVLDDSGT
                     YECRASNIAGQVSGLATINVQEPTLVRIEPDRQHHIVTQGDELSLSCVGSGVPTPSVF
                     WSFEGRDVDRMGVPEGAVFAQPFRTNTADVKIFRVSKENEGIYVCHGSNDAGEDQQYI
                     RVEVQPRRGDVGAGGDDNGDVDTRQPPNRPQIQPNPLSNERLTTELGNNVTLICNVDN
                     VNTEWERVDGTPLPHNAYTVRNTLVIVFVEPQNLGQYRCNGIGRDGRVEAHVVRELVL
                     LPLPRITFYPNIPLTVELGQNLDVYCQVENVRPEDVHWTTDNNRPLPSSVRIEGNVLR
                     FASITQAAAGEYRCSATNQYGSRSKNARVVVKQPSGFQPVPHSQVQQRQVGDSIQLRC
                     RLTTQYGDEVRGNIQFNWYREDGSPLPRGVRPDSQVLQLVKLQPEDEGRYICNSYDLG
                     SGQQLPPVSIDLQVLRTTTQYPFNRFKGGVSLKDTPCMVLYICAAVPAAPQNPIYLPP
                     VAPPRSPERILEPQLSLSVQSSNLPAGDGTTVECFSSDDSYPDVVWERADGAPLSENV
                     QQVGNNLVISNVASTDAGNYVCKCKTDEGDLYTTSYKLEVEEQPHELKSSKIVYAKVG
                     GNADLQCGADEDRQPSYRWSRQYGQLQAGRSLQNEKLSLDRVQANDAGTYVCSAQYSD
                     GETVDFPNILVVTGAIPQFRQEPRSYMSFPTLSNSSFKFNFELTFRPENADGLLLFNG
                     QTRGSGDYIALSLKDRYAEFRFDFGGKPLLVRAEEPLALDEWHTVRVSRFKRDGYIQV
                     DDQHPVAFPTSQHQQIPQLELIEDLYIGGVPNWEFLPAEAVGQQSGFVGCISRLTLQG
                     RTVELIREAKFKEGITDCRPCAQGPCQNKGVCLESQTEQAYTCVCQPGWTGRDCAIEG
                     TQCTAGVCGSGRCENTENDMECLCPLNRAGDRCQYNEILNEQSLNFKSNSFAAYGTPK
                     VTKVNITLSVRPASLEDSVILYTAESTLPSGDYLALVLRGGHAELLINTAARLDPVVV
                     RSAEPLPLNRWTRIEIRRRLGEGILKVGDGPERKAKAPGSDRILSLKTHLFVGGVDRS
                     TVKINRDVNITKGFDGCISKLYNSQKSVNLLGDIRDAANVQNCGEANEIDDDEYEMPV
                     ALPSPKVAENERQLMAPCASDPCENGGSCSEQEDMAICSCPFGFSGKHCQNHLQLSFN
                     ASFRGDGYVELNRSHFQPALEQTYSHIGIVFTTNKPNGLLFWWGQEAGEEYTGQDFIA
                     AAVVDGYVEYSMRLDGEEAVIRNSDIRVDNGERHIVIAKRDENTAMLELDQILDTGDT
                     RPTINKAMKLPGNVFVGGAPDVAAFTGFRYKDNFNGCIVVVEGETVGQINLSSAAING
                     VNANVCPANDEPLGGTEPPVV"
     misc_feature    458..>715
                     /gene="trol"
                     /note="Coiled-coil domain-containing protein 66; Region:
                     CCDC66; pfam15236"
                     /db_xref="CDD:434558"
     misc_feature    1460..1561
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1475..1477,1496..1498,1529..1534)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1508..1510,1517..1519,1529..1531,1547..1552)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1538..1552
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1718..1816
                     /gene="trol"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(1736..1738,1760..1762,1793..1798)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1772..1774,1781..1783,1793..1795,1811..1816)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1802..1816
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1838..1945
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1853..1855,1880..1882,1913..1918)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1892..1894,1901..1903,1913..1915,1931..1936)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1922..1936
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1973..2077
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1988..1990,2012..2014,2045..2050)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2024..2026,2033..2035,2045..2047,2063..2068)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2054..2068
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2231..2338
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2246..2248,2273..2275,2306..2311)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2285..2287,2294..2296,2306..2308,2324..2329)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2315..2329
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2618..2722
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2633..2635,2657..2659,2690..2695)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2669..2671,2678..2680,2690..2692,2708..2713)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2699..2713
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2777..2881
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2792..2794,2816..2818,2849..2854)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2828..2830,2837..2839,2849..2851,2867..2872)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2858..2872
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2900..3001
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2915..2917,2936..2938,2969..2974)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2948..2950,2957..2959,2969..2971,2987..2992)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2978..2992
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3008..3112
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3023..3025,3047..3049,3080..3085)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3059..3061,3068..3070,3080..3082,3098..3103)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3089..3103
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3170..3268
                     /gene="trol"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(3188..3190,3212..3214,3245..3250)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3224..3226,3233..3235,3245..3247,3263..3268)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3254..3268
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3320..3421
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3335..3337,3356..3358,3389..3394)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3368..3370,3377..3379,3389..3391,3407..3412)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3398..3412
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3449..3541
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3452..3454,3476..3478,3509..3514)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3488..3490,3497..3499,3509..3511,3527..3532)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3518..3532
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3542..3646
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3557..3559,3581..3583,3614..3619)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3593..3595,3602..3604,3614..3616,3632..3637)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3623..3637
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3662..3766
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3677..3679,3701..3703,3734..3739)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3713..3715,3722..3724,3734..3736,3752..3757)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3743..3757
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3809..4015
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    4109..4213
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(4124..4126,4148..4150,4181..4186)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4160..4162,4169..4171,4181..4183,4199..4204)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4190..4204
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4229..4333
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(4244..4246,4268..4270,4301..4306)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4280..4282,4289..4291,4301..4303,4319..4324)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4310..4324
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4358..4462
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(4373..4375,4397..4399,4430..4435)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4409..4411,4418..4420,4430..4432,4448..4453)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4439..4453
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4514..4741
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    4523..4537
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    4562..4576
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    4631..4645
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    4673..4690
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    4715..4726
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    5036..5428
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    5597..5758
                     /gene="trol"
                     /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053"
                     /db_xref="CDD:395007"
     misc_feature    order(5597..5599,5603..5605,5639..5641,5669..5671,
                     5675..5677,5702..5704)
                     /gene="trol"
                     /note="EGF-like motif [active]"
                     /db_xref="CDD:238012"
     misc_feature    6131..6541
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    <6542..6622
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domain;
                     laminins are the major noncollagenous components of
                     basement membranes that mediate cell adhesion, growth
                     migration, and differentiation; the laminin-type epidermal
                     growth factor-like module occurs in...; Region: EGF_Lam;
                     cd00055"
                     /db_xref="CDD:238012"
     misc_feature    6644..6793
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domain;
                     laminins are the major noncollagenous components of
                     basement membranes that mediate cell adhesion, growth
                     migration, and differentiation; the laminin-type epidermal
                     growth factor-like module occurs in...; Region: EGF_Lam;
                     cd00055"
                     /db_xref="CDD:238012"
     misc_feature    order(6647..6649,6653..6655,6674..6676,6695..6697,
                     6704..6706,6731..6733)
                     /gene="trol"
                     /note="EGF-like motif [active]"
                     /db_xref="CDD:238012"
     misc_feature    <6902..6994
                     /gene="trol"
                     /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053"
                     /db_xref="CDD:395007"
     misc_feature    7190..7594
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    8057..8305
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    8090..8104
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    8138..8152
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    8195..8209
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    8237..8254
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    8282..8293
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    <8384..8545
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    8636..8887
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    8669..8683
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    8708..8722
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    8777..8791
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    8819..8836
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    8924..9166
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    8975..8989
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409570"
     misc_feature    9014..9028
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409570"
     misc_feature    9071..9085
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409570"
     misc_feature    9113..9130
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409570"
     misc_feature    9152..9163
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409570"
     misc_feature    9218..9448
                     /gene="trol"
                     /note="Immunoglobulin I-set domain; Region: I-set;
                     pfam07679"
                     /db_xref="CDD:400151"
     misc_feature    9242..9256
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    9281..9295
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    9344..9358
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    9386..9403
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    9425..9436
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    9485..9748
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    9515..9529
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    9554..9568
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    9686..9703
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    10121..10351
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    10148..10162
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    10187..10201
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    10247..10261
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    10289..10306
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    10385..>10588
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    10418..10432
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    10466..10489
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    10535..10549
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    10835..11041
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    10907..10921
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    10970..10981
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    11009..11026
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    11111..11311
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    11135..11149
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    11174..11188
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    11231..11245
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    11273..11290
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    11375..11818
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     misc_feature    11885..11983
                     /gene="trol"
                     /note="EGF-like domain; Region: EGF; pfam00008"
                     /db_xref="CDD:394967"
     misc_feature    12125..12586
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     misc_feature    12746..12844
                     /gene="trol"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    12869..13330
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     polyA_site      14129
                     /gene="trol"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attaggttgc gcgccatcgt tccaggcggt cgcacattcc acgtgccata gccgtaacaa
       61 caacctgcca accgcttaaa accaaactca aatacgaacc gaaactgcct tcacacacac
      121 aagtacctaa accaaatcta aatagctgcc aaaagaaacc aaaaattcca gagacgtcgt
      181 agcatccgtt ccccggaaga agaagaagat gggatcgccg ggatcccaag cgcccgcgat
      241 cgcgatcggg atcagtaacg ggcggagagg tcacacgggg tcgctgctcc tgcgcctcct
      301 tctcgtggcc ttcgtcctca acgcctgcca cgtacccccg accaatgcca agcaaattac
      361 gaaaagtaaa gttgatgacc aggactttat actggccgac acacaatcgc tgcagggcag
      421 cgttgacctt gacgatgacg aagcgttcct gattcctccg gattccgaag agaagttgga
      481 taagaagttc acgccggagg gcaactggtg gagccagggg ctccatcgtg ttcgccgctc
      541 cctaaatagc ttcttcggct ccgacgacga tgatcaggaa aaggaacgtg agcgtcagag
      601 gcaaaggcaa aataatcgcg atgccgccaa ccggcaaaag gaacttcggc gccagcaaaa
      661 ggagagccag aaccgcgaga agcagctgcg attggagcgc caggagaggc agcgccttgc
      721 caagcggaac aatcacgtgg tcttcaatcg cgtcaccgat ccccgcaagc gggcatccga
      781 cctttacgac gagaacgagg catctggcct aaacgaggag gaaaccacca cctatcgcac
      841 ctactttgtt gttaatgagc catattcaga cgactacaag gagcgggaca gcctccagtt
      901 ccagaatctg caaaaacttc ttgacgagga cctgcgcaac ttcttcaatc gcaatttcga
      961 aaataacgat gatgaagagc aggaaatcca tagcacccta gagcgagtcg atcaaaccaa
     1021 ggaccatttt aaaattcgcg tgcaacttag ggtagatctg cccagttcaa tcaacgactt
     1081 tggaagtaag ttggagcaac aactgaatgt ctacaagcga atcgatcgtt tgggtgccag
     1141 taccgatggc gtcttcacct ttaccgaatc gagcgtctac aaatacgaac accaatacga
     1201 tattgtgaca ccgagagtaa ttgtatctgg acaaccgata actgaaaaac cagtcgaagc
     1261 accccaagaa ttcgatgagg atcctatcga agttgcattg cccacggatg aggtggaggg
     1321 ctccggccaa gattccggta gctgtcgcgg cgatgccacc ttccagtgtc gaaggagtgg
     1381 aaagactatt tgcgatgaaa tgcgatgcga tggatctcgc gattgtcccg atgccgagga
     1441 cgaggaaggc tgcgaggttt gcaacgaact tcagttcaag tgcgataaca agtgtctgcc
     1501 gctcaataag cgctgcgata atcgatacga ttgtgaggat cagacggacg aggctggttg
     1561 tcaacggtac gaagtagaag agtctcagcc tcagccgcag ccgcaacctc agcctgaacc
     1621 ggaacctgaa cctgaacctg agcctgagcc tgaacctgaa ccagaaccag aacctgaaga
     1681 gcctataaca gacaatgaac agcctgagca aaactcagaa tgccgggcca ccgagttcag
     1741 atgcaacaat ggggactgca tcgatattag aaagcgttgc gatcacattt cggactgtag
     1801 cgaaggcgag gacgagaacg aggagtgccc cgccgcctgc agcggaatgg agtatcaatg
     1861 tcgcgacggc acgcgctgca taagtttgag tcagcagtgc gacggtcatt ccgattgcag
     1921 cgacgccgac gacgaggagc attgcgacgg aagtggtaac gatggtgagg attgtcggtt
     1981 cgatgagttc cgttgcggaa ctggtgagtg cataccgatg cgtcaggtgt gcgataacat
     2041 ctacgattgc aacgattatt ccgatgaggt cagctgcgcc gaggaggagg aagatagtgt
     2101 gggcataccc attggccgtc caccgcagag gccagcgccc aaacacgact ggctggacga
     2161 attggacgcc aatgagtacc acgtctatca tccaagtaat gtctatgagt tggccaattc
     2221 caagaatccc tgtgccagca atcaatttcg ctgcgccacc acgaatgtgt gcatccccct
     2281 gcatttgcgt tgcgataatt tctatcactg caacgatatg agcgatgaga aggactgcga
     2341 gcagtatcaa cgacgcacca ccaccaccac ccgacgacct tcgacctcgg cccggccctc
     2401 cttcaccttc accttcacga cccaggggcc aggcttgctg gagcgtcgca atagcaccac
     2461 cagtagaacc accgcaggca gcaccaccag agccaccgaa gcaccacaat ggccatgggc
     2521 aaccagaccc accgagacca cgaccactaa cccaataaca acagttggcg tagcgaatct
     2581 caatggaaga ttaaataaga ctcgtttggg ggtccagtgc caggaaaacc agtatcaatg
     2641 tggcgatgga agctgcatct ccggctacaa acgctgcaat ggcatcaacg attgcgccga
     2701 tgacgccgac gaatataact gcatctacac ctacaacgaa gactacgtag acccggacga
     2761 caatccattg aatgaatgtg atatccttga gtttgaatgt gactacagtc tgtgtttacc
     2821 gctagagaag aaatgcgatg gctatgcaga ctgtgaagac ttgagcgacg agttcgagtg
     2881 tcagtcgtac acagagaatt gtctattgtc tgagttcgaa tgcgatggct actgcctgcc
     2941 ccgcgatcag ttatgcaacg gaataatcaa ttgccaagat ggcagcgacg agcgcaactg
     3001 taccttttgc cgggaagatg cctacctctg caccaccggc gagtgtgtgg ccgtaaatca
     3061 gagatgcaac ggcatcgtcg aatgcgccga tggcagcgac gagcgtcact gcgtagtcaa
     3121 caccacagag accaactacc attatcccac acacaatcct aaaccaaaaa cctgccgaac
     3181 ccacgagtgg cagtgtacga atctcgagtg catcgagatg agattgaagt gcgatgatgt
     3241 tccggattgc tcggatggat ccgatgagga cctcagcatt tgcttcggca cggccaccac
     3301 acgactaaag cccagcgact gcggtccgga tcagttcttc tgcgatgatt tatgctataa
     3361 tcgctctatt cgatgcaatg gccatatgga ttgctcagat ggcagtgatg agatcgcttg
     3421 tagctcgctg tcagtgcttc catgtccaca gcaccagtgt cccagtggca ggtgttattc
     3481 ggaaagtgag cgatgcgatc gccacaggca ctgcgaggat ggctccgatg aggccaactg
     3541 ctgttacgcg gatcaattcc gctgcaataa tggtgactgc attgcggaat cggctcattg
     3601 cgatggaaat atcgattgta gcgaccagtc cgatgaactc gactgcggag gagactcgca
     3661 gtgtctgccc aaccaattcc gctgcaagaa tggccaatgt gtgagctcta cagcgcgttg
     3721 caacaagcgt tccgattgtt tggatggctc cgatgagcag aattgtgcca atgaacctaa
     3781 caactccgga cgtggaacga accaattgaa actcaagacc tatcccgaca accaaatcat
     3841 taaggagagt cgtgaggtca tcttccgttg ccgtgacgaa ggtcccaacc gcgccaaggt
     3901 caagtggtcg cgacccggcg gacgtcccct gccccccggt ttcaccgatc gcaatggccg
     3961 cctggagatc cccaacatca gggtggagga tgctggcgcc tatgtctgcg aggccgtggg
     4021 ctatgccaac tatattcccg gtcagcacgt caccgtaaac ctcaacgtcg agcgcttaaa
     4081 cgaacgcgaa atccgtccgg actcagcctg tacggagtac caggccacct gcatgaacgg
     4141 cgagtgtatc gataagtcgg gcatctgcga tggacatccg gactgttcgg atggctccga
     4201 tgagcacagc tgcagtttgg gtttgaagtg tcagcccaac cagttcatgt gctccaattc
     4261 caagtgtgtg gatcgcacct ggcgctgtga tggcgagaac gactgcggcg ataactccga
     4321 tgagacctct tgcgatccgg aaccaagtga tgctccgtgc cgatacgacg aattccagtg
     4381 ccgcagcggt cattgcattc ccaagagctt ccagtgcgac tatatgaacg attgtaccga
     4441 tggtaccgat gaaattggat gctcggtgcc ctctccaatg accctacccg caccctcgat
     4501 tgtcgtgatg gagtacgagg tcctcgagct gacctgcgtg ggcaccggcg tcccgacgcc
     4561 gacgatcgtg tggcgtctca actggggcca tgtgcccgag aagtgtgaat cgaagagcta
     4621 cggcggaacc ggaaccctgc gctgtccgaa catgaggccc caggacagtg gtgcctactc
     4681 gtgcgagttc atcaacacac gcggcacctt ctatccgaaa acgaactcga ttgtcaccgt
     4741 tacgccggtg cgctcggatg tctgcaaggc cggattcttc aatatgctgg cccgcaagtc
     4801 ggaggaatgc gtccagtgct tctgctttgg cgtttcgacc aactgtgaca gtgccaattt
     4861 gttcacctac gccattcagc caccgatcct ttcgcaccgc gtggtcagcg ttgaactcag
     4921 tccgttccgt caaattgtca tcaatgaggc tagtccgggt caggatctgc tcaccttgca
     4981 ccatggtgtt cagttcaggg catcgaacgt acactacaac ggccgggaga caccattctt
     5041 ggccctgccc gctgagtata tgggcaacca gctgaagtcc tatggcggca atctgcgcta
     5101 cgaggtcagg tacaatggca acggtagacc ggtcagcgga cccgatgtca tcatcaccgg
     5161 caacagtttc acgctaaccc atcgcgttcg cactcatccg ggtcagaaca acagggtgac
     5221 tattcccttc ctgccgggag gctggacgaa gccggatggt cgcaagggaa cgcgagagga
     5281 catcatgatg atactggcca atgtggacaa tattctgatt cgactgggct acctggatag
     5341 cacagctcgc gaagtggatc tgataaatat cgccttggat tcggccggaa gtgccgatca
     5401 gggattgggc agtgcctcgc tcgtggagaa gtgcacctgt ccgcccggct atgttggtga
     5461 ttcgtgcgag tcctgtgcct cgggctatgt tcgccaggcc cgcggacctt ggctgggtca
     5521 ttgtgtgccc ttcaccccgg aaccgtgccc agcgggaacc tacggcaatc cccgacttgg
     5581 tgttccctgc caggagtgtc cgtgccccca cgcgggcgcc aataactttg ccagcggctg
     5641 ccaacagagt cccgatggcg atgtgatttg ccgctgcaac gaaggctatg ccggcaagag
     5701 gtgcgagcac tgcgcccagg gttaccaggg taatccgttg gcaccgggag gagtctgtcg
     5761 caagataccc gatagttcgt gcaatgtcga cggcacctac aacatctaca gcaatggaac
     5821 gtgccagtgc aaggatagcg tgattggcga acagtgcgac acctgcgcgc cgaagagttt
     5881 ccacctcaat tcgttcacct acaccggttg catcgagtgc ttctgcagtg gagtgggctt
     5941 ggattgtgac agtagttcgt ggtatcgcaa ccaggtcacc agcacctttg gacgaacgcg
     6001 cgtcaatcat ggattcgccc tgattagcga ctatatgcgc aataccccgg taacggtgcc
     6061 cgtttccatg tccacccagg ccaatgcctt gagcttcgtg ggatccgccg agcaggccgg
     6121 taatacgctc tactggagtc ttcccgccgc cttcctgggc aacaagctga cctcgtacgg
     6181 aggcaagttg agctacacgc tcagctacag tcccctgccc agcggcatta tgtcgcgcaa
     6241 cagtgccccc gatgtggtga tcaagagcgg cgaggatctg aggctcatcc attacaggaa
     6301 gtcgcaggtc agtcccagtg tggccaacac ctatgccgtg gagatcaagg agagcgcatg
     6361 gcagcgcggc gatgaactgg tgcctaaccg tgaacacgtc ctgatggccc tcagcaatat
     6421 tacggccatc tatatcaagg ccacgtacac gactagcacc aaggaggcct cgctgcgatc
     6481 ggtcacattg gatacggcca cggccaccaa tctgggcacc gcacgtgccg tcgaagtgga
     6541 gcagtgccgc tgtcccgagg gctatttggg tctctcctgc gagcagtgtg ctcctggcta
     6601 tacgcgcgat ccggaggcag gaatctatct gggtctctgc aggccctgcg agtgcaatgg
     6661 acattccaag tattgcaaca gtgagacagg cgaatgcgaa agctgttccg acaacaccga
     6721 aggattcaat tgtgaccgat gcgccgccgg ctatgtgggt gatgccaccc gaggaacttc
     6781 gtacgactgt caatacgatg acggcggcta tccgacgtcg cgtccaccgg caccgggcaa
     6841 tcagacggcc gaatgcctgg tgaattgcca acaggaggga accgccggtt gccgcggcta
     6901 ccagtgcgag tgcaagagga atgtggctgg cgatcgatgc gatcagtgcc gccccggaac
     6961 ctatggactg tcggcccaaa atccggacgg ttgcaaggag tgctactgct ccggactgac
     7021 caaccagtgc cgctcggcgt ctctctaccg ccagctgata cccgtggact tcatttcgac
     7081 gccaccattg ataacagacg aattcggcga catcatggat agggataacc ttgtgcccga
     7141 cgtgcccagg aatgtgtata cctacaagca cacctcctac acgcccaagt actggagcct
     7201 gaggggtagt gtgctgggca accagctgtt gtcgtacggc ggccgcttgg agtacagcct
     7261 gattgtggag tccgttggcc gggaccatcg tggcaaggat gtggtcctaa ttggcaacgg
     7321 actcaagctg atctggtcgc gacccgatgg ccatgacaac gagcaggaat accatgtgcg
     7381 tttgcatgag gacgagcagt ggacggttga ggatcgtgga tcggcacgac aggccacgcg
     7441 ggccgacttc atgactgtgc tgtcggatct gcagcacatc ctgatcctgg ccacacccaa
     7501 ggtgcccacg gtcagcacct cgattagcaa tgtcatcctg gagagttcga taaccacgag
     7561 agcgcctgga gctacgcatg cctccgatat cgagttgtgc cagtgtccat ccggttatac
     7621 gggcacttcc tgtgagtcct gcgcaccact gcactaccgc gacgcctctg gacgctgcag
     7681 tcagtgtcct tgcgacgctt ccaacacgga atcctgcggc ttggtcagcg gcggtaacgt
     7741 cgaatgccag tgcaggccac gctggagggg tgatcgctgc cgggaaattg acacatcgcc
     7801 cattatcgaa gaaccgcccc agatatgtga tttaagcagg ggattctgtt gcagcggctt
     7861 tcagttcgat atcgcaccga acgagacaat ctcgtttaat gacaccctgc agatatataa
     7921 gggcaacaga atcataggaa atatgaccaa gctgcgctac ggctgtccat cgcgagaaac
     7981 taacgaaccg actccggaac cggataccag taccgatgat cccgtgcgca cccagatcat
     8041 agtgtcgatt gccaggccag agattaccat tctgcccgtg ggtggatcgc tgaccctcag
     8101 ctgtaccggt cgaatgcgct ggaccaatag cccagtgttt gtgaactggt acaagcaggg
     8161 cagtcacctg cccgagggag tcgaggtgca aggcggtaat ctgcagctgt tcaacctgca
     8221 gatcagcgat tctggaatct acatctgcca ggccgtaagc aacgagaccg gccacagctt
     8281 tacggaccac gtctccatca ccgtttccca ggaggaccaa cgctcgccgg ctcacattgt
     8341 ggatttgccc aacgacgtga ccttcgagga gtacgtaagc aatgagatcg tctgcgaggt
     8401 ggagggcaac ccaccaccca ctgtcacctg gactcgcgtg gatggccatg cggacgccca
     8461 aagtacgcga acggacaaca atcggctggt cttcgattcg ccgaggaaat cggacgaggg
     8521 tcgctatcgc tgccaggcag agaatagcct gagtcgggag gagaagtacg tagtcgtgta
     8581 tgtccggagc aatcctcccc agccgccgcc gcagcaggat cgtttgtaca tcacaccgca
     8641 ggaggtgaac ggtgtggccg gtgactcctt ccagttgtcc tgccaattca ccagcgctgc
     8701 ctctctgcgc tacgattggt cccacgatgg tcgctccctg tccgcgtcgt caccccgaaa
     8761 tgttgtggtc cgcggaaatg tcctggaagt ccgcgatgcc aacgttcgcg actccggcac
     8821 ctacacctgt gtggccttcg acctgcgcac ccgacgcaac ttcaccgaga gcgcacgggt
     8881 ctacatcgag cagcccaacg agccgggaat ccttggcgac aagccgcata tcttgacctt
     8941 ggagcagaac atcataattg tgcaaggcga ggacttgagc atcacatgtg aggcaagtgg
     9001 aacgccctat ccctcgatta agtggaccaa ggtgcaggag aatctggccg aaaatgtccg
     9061 catcagtggc aatgtgctca ccatctacgg aggccgcagt gagaatcgtg gtctttactc
     9121 ctgcatcgcc gagaactctc acggcagcga tcagtccagc acaagcatcg atattgaacc
     9181 ccgggagcgg ccgagtctta cgattgatac ggccacccaa aaggtttcgg ttggctccca
     9241 ggcgtccctt tactgtgccg cccagggcat tcccgaaccg accgtcgagt gggttcgaac
     9301 ggatggtcag ccactgtcgc cgcgtcacaa ggtccaggca cccggctatg ttgtgatcga
     9361 tgacattgtg ctcgatgata gcggtaccta cgagtgccgg gcgagcaaca tagctggcca
     9421 ggtgagcggc ttggccacca ttaacgtcca ggagccaact cttgtgcgga tcgaaccaga
     9481 taggcaacac catatcgtca cccagggcga cgaactctcg ctcagctgcg tgggcagtgg
     9541 cgtccctact ccttcggtct tttggagttt cgagggaaga gacgttgaca ggatgggagt
     9601 accggaaggt gctgtttttg cgcaaccttt ccgaaccaac actgccgacg tgaaaatctt
     9661 ccgggtgagc aaggagaacg aaggcatcta cgtctgtcac ggatccaatg acgcgggtga
     9721 agatcaacaa tacattcgcg tggaggtaca acccagacgg ggtgacgtcg gtgcaggagg
     9781 agatgacaat ggtgatgtcg atacccgaca gccccccaat cggccccaaa tccaaccgaa
     9841 tccattgagc aacgaacgcc tgaccaccga attgggcaac aatgtgaccc tcatctgcaa
     9901 cgtggacaac gtgaacacgg aatgggaacg cgtcgatggc acacccctgc cgcacaatgc
     9961 ctacacggtg agaaatacgc tggtgattgt cttcgtggag ccgcagaatc tgggtcagta
    10021 ccgctgcaat ggaatcggtc gcgatggacg tgtggaggcc catgtggtga gggagctggt
    10081 tctcctgccc ctgcccagga tcaccttcta tcccaacatc ccgctgaccg tggagctggg
    10141 ccagaacttg gatgtctact gccaggtgga gaacgtgcgt ccggaggacg tgcattggac
    10201 caccgacaac aatcgaccac tgcccagttc cgtacgcatc gagggcaatg tcctcaggtt
    10261 cgcgtccatc actcaggctg ctgccggtga ataccgctgc tcggccacca atcaatatgg
    10321 aagccgatcg aagaacgcca gggtggtggt gaaacagccc agtggcttcc agcccgttcc
    10381 ccactcgcag gtgcaacagc gtcaggtggg cgactccatc cagttgcgat gccgcctgac
    10441 cacccagtac ggcgacgagg ttcgcggcaa tatccagttc aactggtacc gtgaggacgg
    10501 cagccccttg ccccgcggtg tccgtccgga tagccaggtg ctgcagctgg ttaaattgca
    10561 gcccgaggac gagggccgct acatctgcaa ctcgtacgat ttgggcagcg ggcagcaact
    10621 gccccccgtc tccatcgact tgcaagtact aagaactact acccagtatc ctttcaatcg
    10681 gtttaagggc ggtgtctccc tgaaagacac gccctgcatg gttctgtata tttgtgcagc
    10741 ggtaccagcg gctccccaga accccatcta cctgccgcca gtggcgccac cacgttcgcc
    10801 cgaaaggatc ctcgagcccc aactgagcct gagtgtacaa tcctcgaacc tgccagccgg
    10861 cgacggcacc accgtcgagt gcttctcctc cgatgactcc tacccagatg tcgtgtggga
    10921 acgcgccgat ggagctccac tcagcgaaaa tgtccagcaa gtgggcaata acctggtgat
    10981 tagtaacgtg gcctccaccg atgccggtaa ctatgtgtgc aagtgcaaga cggacgaggg
    11041 agatctgtat accaccagct acaaactgga ggtcgaggag cagccccatg aactgaagag
    11101 ctccaagata gtctacgcca aggttggcgg aaatgccgac ttgcagtgcg gagccgatga
    11161 agatcgacag cccagctacc gttggtctcg ccaatacgga caacttcagg cgggacgcag
    11221 tctgcagaat gagaaacttt cgttggatcg cgttcaggcc aacgatgccg gaacttatgt
    11281 ttgttcggcc caatacagcg atggcgagac ggttgacttc cccaacattc tggttgtgac
    11341 cggggcgatt ccccagttcc gccaggagcc ccgcagctac atgagcttcc ccacgctctc
    11401 gaactcctcg ttcaagttca acttcgagct gaccttccgg ccggaaaacg ccgacggact
    11461 gctgctcttc aatggacaga cccgcggaag cggtgactat atcgcactct cgctgaagga
    11521 tcgctatgcg gagttccggt tcgattttgg cggtaaaccg ttgctggtgc gagcggagga
    11581 gccactggct ttggatgaat ggcacacggt gcgcgtgagt cgcttcaagc gggatggcta
    11641 catccaggtg gacgaccagc atccggtggc cttccccacc tcccagcatc agcagatacc
    11701 ccagttggaa ctgattgagg atctgtacat tggcggcgtg cccaactggg agttcctgcc
    11761 cgccgaggcg gtgggtcagc aatcaggctt cgtgggctgc attagccggc tgaccctgca
    11821 gggacgcacc gtggagctga tccgggaggc caagttcaag gagggcatca ccgattgccg
    11881 gccctgcgcc cagggaccct gccagaacaa gggcgtctgc ctggagagcc agacggagca
    11941 ggcctacacc tgcgtctgcc agccgggctg gactggccgg gattgtgcca tcgagggcac
    12001 ccagtgcacc gcaggagttt gcggctcggg acgctgcgag aatacggaga acgacatgga
    12061 gtgcctgtgc ccgctgaaca gggcaggcga tcgatgccag tacaatgaga ttctaaatga
    12121 acagagcttg aatttcaaga gcaacagctt tgcggcctac ggaactccca aggtcaccaa
    12181 agtaaacatc acactctccg ttcgtcccgc gagcctggag gactctgtga tcctgtacac
    12241 ggcggaatcc actctgccca gcggcgatta cctggctttg gtccttcgcg gtggccacgc
    12301 ggagctgctg atcaacacgg ccgcccgctt ggatcccgtg gtggtgcgtt cggcggaacc
    12361 gctgcccctc aatcgctgga ccagaatcga gatcaggcgt cgcctgggcg agggaatcct
    12421 caaggtgggc gatggacccg agcgaaaggc caaggcaccg ggatccgatc gcattctgtc
    12481 gctcaagacc cacctctttg tgggcggcgt cgatcggtcg accgtaaaga tcaaccgtga
    12541 tgtgaacatc accaagggct tcgatggctg catctcgaag ctgtacaact cgcagaaatc
    12601 cgtcaatctg ctgggtgaca tcagggatgc ggcgaatgtc cagaactgtg gggaggcgaa
    12661 tgagatagat gacgatgagt atgagatgcc agtagcgctg ccatcgccta aggtcgccga
    12721 gaatgaacgt cagctgatgg cgccgtgtgc cagtgatccc tgcgagaacg ggggaagctg
    12781 cagcgagcag gaggacatgg ccatctgctc ctgtcccttc ggcttcagcg gcaaacactg
    12841 ccagaatcac ctccagctga gcttcaatgc ctcgttccgc ggcgatggct acgtggagct
    12901 gaaccgcagc cacttccaac ccgccctgga gcagacgtac tcccacattg gcattgtgtt
    12961 caccaccaac aagccgaatg gcctgctttt ctggtggggc caggaggccg gggaggagta
    13021 caccggacag gacttcattg ccgccgccgt ggtcgatggc tatgtggagt actcgatgag
    13081 gctcgatggc gaggaggcgg tcattcggaa cagcgatatc cgcgtggaca atggcgagcg
    13141 gcacattgtg atcgccaagc gggatgagaa caccgccatg ctggaactcg atcagatcct
    13201 ggacacgggc gatacgcgac ccaccatcaa caaggcaatg aagctgccgg gcaatgtgtt
    13261 tgtcggtggc gctcctgatg tcgcggcatt cacgggcttc cgctacaagg acaatttcaa
    13321 cggctgcatt gtggtcgtcg agggcgaaac cgtgggccaa attaacctta gttcagctgc
    13381 catcaatgga gtgaatgcca acgtgtgtcc cgctaacgac gaacctctgg gaggaaccga
    13441 accgccagtc gtctgaggac acaaccagca accgaaatta gctttttaat taaacattaa
    13501 caaatgaaac aaaaagaaaa acaattttta tatatacaac atatgaataa gccccaagca
    13561 aacctacaaa aaattgaata ttatacgacg aacagataat ataaaaacaa aaaaagagag
    13621 aaacgatcac ttctactaca attgcttctt cgatccttaa gtctaggtta aagattgtag
    13681 caagaaaaca agcgaatatc acaaacattt atttaacaag aacgccatgc gagaagtgaa
    13741 acgaaacaga aacaataatg caattaatgc agataataca gataaagcct agaaccctaa
    13801 gaactaacta actaactcga acaagaacaa caacgcatac tagccaactg caaccacaac
    13861 aaccacaata gtgaaggcat tttaattata attttagtct ctagcttata actatgacta
    13921 cgactcgttt tttttgtgag cccagtgtaa aatgttggaa atcggaaatt ggccctacac
    13981 acaaacacac acaagttatt aattaaatac caattgatac catataatga taaatgaaat
    14041 actatgaatg caactattgt gaacgaacga aaaccgttga gtggataaaa agcataagca
    14101 gaagatatat taaaatgaaa tcaacaaca