Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii terribly reduced optic lobes


LOCUS       XM_070218422           14282 bp    mRNA    linear   INV 09-DEC-2024
            (trol), transcript variant X5, mRNA.
ACCESSION   XM_070218422
VERSION     XM_070218422.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..14282
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..14282
                     /gene="trol"
                     /note="terribly reduced optic lobes; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 9
                     Proteins"
                     /db_xref="GeneID:108055788"
     CDS             209..13609
                     /gene="trol"
                     /codon_start=1
                     /product="basement membrane-specific heparan sulfate
                     proteoglycan core protein isoform X5"
                     /protein_id="XP_070074523.1"
                     /db_xref="GeneID:108055788"
                     /translation="MGSPGSQAPAIAIGISNGRRGHTGSLLLRLLLVAFVLNACHVPP
                     TNAKQITKSKVDDQDFILADTQSLQGSVDLDDDEAFLIPPDSEEKLDKKFTPEGNWWS
                     QGLHRVRRSLNSFFGSDDDDQEKERERQRQRQNNRDAANRQKELRRQQKESQNREKQL
                     RLERQERQRLAKRNNHVVFNRVTDPRKRASDLYDENEASGLNEEETTTYRTYFVVNEP
                     YSDDYKERDSLQFQNLQKLLDEDLRNFFNRNFENNDDEEQEIHSTLERVDQTKDHFKI
                     RVQLRVDLPSSINDFGSKLEQQLNVYKRIDRLGASTDGVFTFTESSEFDEDPIEVALP
                     TDEVEGSGQDSGSCRGDATFQCRRSGKTICDEMRCDGSRDCPDAEDEEGCEVCNELQF
                     KCDNKCLPLNKRCDNRYDCEDQTDEAGCQRYEVEESQPQPQPQPQPEPEPEPEPEPEP
                     EPEPEPEPEEPITDNEQPEQNSECRATEFRCNNGDCIDIRKRCDHISDCSEGEDENEE
                     CPAACSGMEYQCRDGTRCISLSQQCDGHSDCSDADDEEHCDGSGNDGEDCRFDEFRCG
                     TGECIPMRQVCDNIYDCNDYSDEVSCAEEEEDSVGIPIGRPPQRPAPKHDWLDELDAN
                     EYHVYHPSNVYELANSKNPCASNQFRCATTNVCIPLHLRCDNFYHCNDMSDEKDCEQY
                     QRRTTTTTRRPSTSARPSFTFTFTTQGPGLLERRNSTTSRTTAGSTTRATEAPQWPWA
                     TRPTETTTTNPITTVGVASSSPQSSCLENIEFACHNRDCIPIESVCDGTPDCGRSEDE
                     DDALCKCTADKYKCQHGGGCIPKTQVCDGKPQCRDRSDESACHLNGRLNKTRLGVQCQ
                     ENQYQCGDGSCISGYKRCNGINDCADDADEYNCIYTYNEDYVDPDDNPLNECDILEFE
                     CDYSLCLPLEKKCDGYADCEDLSDEFECQSYTENCLLSEFECDGYCLPRDQLCNGIIN
                     CQDGSDERNCTFCREDAYLCTTGECVAVNQRCNGIVECADGSDERHCVVNTTETNYHY
                     PTHNPKPKTCRTHEWQCTNLECIEMRLKCDDVPDCSDGSDEDLSICFGTATTRLKPSD
                     CGPDQFFCDDLCYNRSIRCNGHMDCSDGSDEIACSSLSVLPCPQHQCPSGRCYSESER
                     CDRHRHCEDGSDEANCCYADQFRCNNGDCIAESAHCDGNIDCSDQSDELDCGGDSQCL
                     PNQFRCKNGQCVSSTARCNKRSDCLDGSDEQNCANEPNNSGRGTNQLKLKTYPDNQII
                     KESREVIFRCRDEGPNRAKVKWSRPGGRPLPPGFTDRNGRLEIPNIRVEDAGAYVCEA
                     VGYANYIPGQHVTVNLNVERLNEREIRPDSACTEYQATCMNGECIDKSGICDGHPDCS
                     DGSDEHSCSLGLKCQPNQFMCSNSKCVDRTWRCDGENDCGDNSDETSCDPEPSDAPCR
                     YDEFQCRSGHCIPKSFQCDYMNDCTDGTDEIGCSVPSPMTLPAPSIVVMEYEVLELTC
                     VGTGVPTPTIVWRLNWGHVPEKCESKSYGGTGTLRCPNMRPQDSGAYSCEFINTRGTF
                     YPKTNSIVTVTPVRSDVCKAGFFNMLARKSEECVQCFCFGVSTNCDSANLFTYAIQPP
                     ILSHRVVSVELSPFRQIVINEASPGQDLLTLHHGVQFRASNVHYNGRETPFLALPAEY
                     MGNQLKSYGGNLRYEVRYNGNGRPVSGPDVIITGNSFTLTHRVRTHPGQNNRVTIPFL
                     PGGWTKPDGRKGTREDIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGSADQGL
                     GSASLVEKCTCPPGYVGDSCESCASGYVRQARGPWLGHCVPFTPEPCPAGTYGNPRLG
                     VPCQECPCPHAGANNFASGCQQSPDGDVICRCNEGYAGKRCEHCAQGYQGNPLAPGGV
                     CRKIPDSSCNVDGTYNIYSNGTCQCKDSVIGEQCDTCAPKSFHLNSFTYTGCIECFCS
                     GVGLDCDSSSWYRNQVTSTFGRTRVNHGFALISDYMRNTPVTVPVSMSTQANALSFVG
                     SAEQAGNTLYWSLPAAFLGNKLTSYGGKLSYTLSYSPLPSGIMSRNSAPDVVIKSGED
                     LRLIHYRKSQVSPSVANTYAVEIKESAWQRGDELVPNREHVLMALSNITAIYIKATYT
                     TSTKEASLRSVTLDTATATNLGTARAVEVEQCRCPEGYLGLSCEQCAPGYTRDPEAGI
                     YLGLCRPCECNGHSKYCNSETGECESCSDNTEGFNCDRCAAGYVGDATRGTSYDCQYD
                     DGGYPTSRPPAPGNQTAECLVNCQQEGTAGCRGYQCECKRNVAGDRCDQCRPGTYGLS
                     AQNPDGCKECYCSGLTNQCRSASLYRQLIPVDFISTPPLITDEFGDIMDRDNLVPDVP
                     RNVYTYKHTSYTPKYWSLRGSVLGNQLLSYGGRLEYSLIVESVGRDHRGKDVVLIGNG
                     LKLIWSRPDGHDNEQEYHVRLHEDEQWTVEDRGSARQATRADFMTVLSDLQHILILAT
                     PKVPTVSTSISNVILESSITTRAPGATHASDIELCQCPSGYTGTSCESCAPLHYRDAS
                     GRCSQCPCDASNTESCGLVSGGNVECQCRPRWRGDRCREIDTSPIIEEPPQICDLSRG
                     FCCSGFQFDIAPNETISFNDTLQIYKGNRIIGNMTKLRYGCPSRETNEPTPEPDTSTD
                     DPVRTQIIVSIARPEITILPVGGSLTLSCTGRMRWTNSPVFVNWYKQGSHLPEGVEVQ
                     GGNLQLFNLQISDSGIYICQAVSNETGHSFTDHVSITVSQEDQRSPAHIVDLPNDVTF
                     EEYVSNEIVCEVEGNPPPTVTWTRVDGHADAQSTRTDNNRLVFDSPRKSDEGRYRCQA
                     ENSLSREEKYVVVYVRSNPPQPPPQQDRLYITPQEVNGVAGDSFQLSCQFTSAASLRY
                     DWSHDGRSLSASSPRNVVVRGNVLEVRDANVRDSGTYTCVAFDLRTRRNFTESARVYI
                     EQPNEPGILGDKPHILTLEQNIIIVQGEDLSITCEASGTPYPSIKWTKVQENLAENVR
                     ISGNVLTIYGGRSENRGLYSCIAENSHGSDQSSTSIDIEPRERPSLTIDTATQKVSVG
                     SQASLYCAAQGIPEPTVEWVRTDGQPLSPRHKVQAPGYVVIDDIVLDDSGTYECRASN
                     IAGQVSGLATINVQEPTLVRIEPDRQHHIVTQGDELSLSCVGSGVPTPSVFWSFEGRD
                     VDRMGVPEGAVFAQPFRTNTADVKIFRVSKENEGIYVCHGSNDAGEDQQYIRVEVQPR
                     RGDVGAGGDDNGDVDTRQPPNRPQIQPNPLSNERLTTELGNNVTLICNVDNVNTEWER
                     VDGTPLPHNAYTVRNTLVIVFVEPQNLGQYRCNGIGRDGRVEAHVVRELVLLPLPRIT
                     FYPNIPLTVELGQNLDVYCQVENVRPEDVHWTTDNNRPLPSSVRIEGNVLRFASITQA
                     AAGEYRCSATNQYGSRSKNARVVVKQPSGFQPVPHSQVQQRQVGDSIQLRCRLTTQYG
                     DEVRGNIQFNWYREDGSPLPRGVRPDSQVLQLVKLQPEDEGRYICNSYDLGSGQQLPP
                     VSIDLQVLRTTTQYPFNRFKGGVSLKDTPCMVLYICAAVPAAPQNPIYLPPVAPPRSP
                     ERILEPQLSLSVQSSNLPAGDGTTVECFSSDDSYPDVVWERADGAPLSENVQQVGNNL
                     VISNVASTDAGNYVCKCKTDEGDLYTTSYKLEVEEQPHELKSSKIVYAKVGGNADLQC
                     GADEDRQPSYRWSRQYGQLQAGRSLQNEKLSLDRVQANDAGTYVCSAQYSDGETVDFP
                     NILVVTGAIPQFRQEPRSYMSFPTLSNSSFKFNFELTFRPENADGLLLFNGQTRGSGD
                     YIALSLKDRYAEFRFDFGGKPLLVRAEEPLALDEWHTVRVSRFKRDGYIQVDDQHPVA
                     FPTSQHQQIPQLELIEDLYIGGVPNWEFLPAEAVGQQSGFVGCISRLTLQGRTVELIR
                     EAKFKEGITDCRPCAQGPCQNKGVCLESQTEQAYTCVCQPGWTGRDCAIEGTQCTAGV
                     CGSGRCENTENDMECLCPLNRAGDRCQYNEILNEQSLNFKSNSFAAYGTPKVTKVNIT
                     LSVRPASLEDSVILYTAESTLPSGDYLALVLRGGHAELLINTAARLDPVVVRSAEPLP
                     LNRWTRIEIRRRLGEGILKVGDGPERKAKAPGSDRILSLKTHLFVGGVDRSTVKINRD
                     VNITKGFDGCISKLYNSQKSVNLLGDIRDAANVQNCGEANEIDDDEYEMPVALPSPKV
                     AENERQLMAPCASDPCENGGSCSEQEDMAICSCPFGFSGKHCQNHLQLSFNASFRGDG
                     YVELNRSHFQPALEQTYSHIGIVFTTNKPNGLLFWWGQEAGEEYTGQDFIAAAVVDGY
                     VEYSMRLDGEEAVIRNSDIRVDNGERHIVIAKRDENTAMLELDQILDTGDTRPTINKA
                     MKLPGNVFVGGAPDVAAFTGFRYKDNFNGCIVVVEGETVGQINLSSAAINGVNANVCP
                     ANDEPLGGTEPPVV"
     misc_feature    458..>715
                     /gene="trol"
                     /note="Coiled-coil domain-containing protein 66; Region:
                     CCDC66; pfam15236"
                     /db_xref="CDD:434558"
     misc_feature    1367..1468
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1382..1384,1403..1405,1436..1441)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1415..1417,1424..1426,1436..1438,1454..1459)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1445..1459
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1625..1723
                     /gene="trol"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(1643..1645,1667..1669,1700..1705)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1679..1681,1688..1690,1700..1702,1718..1723)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1709..1723
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1745..1852
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1760..1762,1787..1789,1820..1825)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1799..1801,1808..1810,1820..1822,1838..1843)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1829..1843
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1880..1984
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1895..1897,1919..1921,1952..1957)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1931..1933,1940..1942,1952..1954,1970..1975)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1961..1975
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2138..2245
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2153..2155,2180..2182,2213..2218)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2192..2194,2201..2203,2213..2215,2231..2236)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2222..2236
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2504..2608
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2522..2524,2546..2548,2579..2584)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2558..2560,2567..2569,2579..2581,2597..2602)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2588..2602
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2621..2728
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2636..2638,2663..2665,2696..2701)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2675..2677,2684..2686,2696..2698,2714..2719)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2705..2719
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2771..2875
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2786..2788,2810..2812,2843..2848)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2822..2824,2831..2833,2843..2845,2861..2866)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2852..2866
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2930..3034
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2945..2947,2969..2971,3002..3007)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2981..2983,2990..2992,3002..3004,3020..3025)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3011..3025
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3053..3154
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3068..3070,3089..3091,3122..3127)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3101..3103,3110..3112,3122..3124,3140..3145)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3131..3145
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3161..3265
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3176..3178,3200..3202,3233..3238)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3212..3214,3221..3223,3233..3235,3251..3256)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3242..3256
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3323..3421
                     /gene="trol"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(3341..3343,3365..3367,3398..3403)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3377..3379,3386..3388,3398..3400,3416..3421)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3407..3421
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3473..3574
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3488..3490,3509..3511,3542..3547)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3521..3523,3530..3532,3542..3544,3560..3565)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3551..3565
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3602..3694
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3605..3607,3629..3631,3662..3667)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3641..3643,3650..3652,3662..3664,3680..3685)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3671..3685
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3695..3799
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3710..3712,3734..3736,3767..3772)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3746..3748,3755..3757,3767..3769,3785..3790)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3776..3790
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3815..3919
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3830..3832,3854..3856,3887..3892)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3866..3868,3875..3877,3887..3889,3905..3910)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3896..3910
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3962..4168
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    4262..4366
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(4277..4279,4301..4303,4334..4339)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4313..4315,4322..4324,4334..4336,4352..4357)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4343..4357
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4382..4486
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(4397..4399,4421..4423,4454..4459)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4433..4435,4442..4444,4454..4456,4472..4477)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4463..4477
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4511..4615
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(4526..4528,4550..4552,4583..4588)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4562..4564,4571..4573,4583..4585,4601..4606)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4592..4606
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4667..4894
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    4676..4690
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    4715..4729
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    4784..4798
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    4826..4843
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    4868..4879
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    5189..5581
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    5750..5911
                     /gene="trol"
                     /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053"
                     /db_xref="CDD:395007"
     misc_feature    order(5750..5752,5756..5758,5792..5794,5822..5824,
                     5828..5830,5855..5857)
                     /gene="trol"
                     /note="EGF-like motif [active]"
                     /db_xref="CDD:238012"
     misc_feature    6284..6694
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    <6695..6775
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domain;
                     laminins are the major noncollagenous components of
                     basement membranes that mediate cell adhesion, growth
                     migration, and differentiation; the laminin-type epidermal
                     growth factor-like module occurs in...; Region: EGF_Lam;
                     cd00055"
                     /db_xref="CDD:238012"
     misc_feature    6797..6946
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domain;
                     laminins are the major noncollagenous components of
                     basement membranes that mediate cell adhesion, growth
                     migration, and differentiation; the laminin-type epidermal
                     growth factor-like module occurs in...; Region: EGF_Lam;
                     cd00055"
                     /db_xref="CDD:238012"
     misc_feature    order(6800..6802,6806..6808,6827..6829,6848..6850,
                     6857..6859,6884..6886)
                     /gene="trol"
                     /note="EGF-like motif [active]"
                     /db_xref="CDD:238012"
     misc_feature    <7055..7147
                     /gene="trol"
                     /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053"
                     /db_xref="CDD:395007"
     misc_feature    7343..7747
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    8210..8458
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    8243..8257
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    8291..8305
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    8348..8362
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    8390..8407
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    8435..8446
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    <8537..8698
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    8789..9040
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    8822..8836
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    8861..8875
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    8930..8944
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    8972..8989
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    9077..9319
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    9128..9142
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409570"
     misc_feature    9167..9181
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409570"
     misc_feature    9224..9238
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409570"
     misc_feature    9266..9283
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409570"
     misc_feature    9305..9316
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409570"
     misc_feature    9371..9601
                     /gene="trol"
                     /note="Immunoglobulin I-set domain; Region: I-set;
                     pfam07679"
                     /db_xref="CDD:400151"
     misc_feature    9395..9409
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    9434..9448
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    9497..9511
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    9539..9556
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    9578..9589
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    9638..9901
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    9668..9682
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    9707..9721
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    9839..9856
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    10274..10504
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    10301..10315
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    10340..10354
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    10400..10414
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    10442..10459
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    10538..>10741
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    10571..10585
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    10619..10642
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    10688..10702
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    10988..11194
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    11060..11074
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    11123..11134
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    11162..11179
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    11264..11464
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    11288..11302
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    11327..11341
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    11384..11398
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    11426..11443
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    11528..11971
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     misc_feature    12038..12136
                     /gene="trol"
                     /note="EGF-like domain; Region: EGF; pfam00008"
                     /db_xref="CDD:394967"
     misc_feature    12278..12739
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     misc_feature    12899..12997
                     /gene="trol"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    13022..13483
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     polyA_site      14282
                     /gene="trol"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attaggttgc gcgccatcgt tccaggcggt cgcacattcc acgtgccata gccgtaacaa
       61 caacctgcca accgcttaaa accaaactca aatacgaacc gaaactgcct tcacacacac
      121 aagtacctaa accaaatcta aatagctgcc aaaagaaacc aaaaattcca gagacgtcgt
      181 agcatccgtt ccccggaaga agaagaagat gggatcgccg ggatcccaag cgcccgcgat
      241 cgcgatcggg atcagtaacg ggcggagagg tcacacgggg tcgctgctcc tgcgcctcct
      301 tctcgtggcc ttcgtcctca acgcctgcca cgtacccccg accaatgcca agcaaattac
      361 gaaaagtaaa gttgatgacc aggactttat actggccgac acacaatcgc tgcagggcag
      421 cgttgacctt gacgatgacg aagcgttcct gattcctccg gattccgaag agaagttgga
      481 taagaagttc acgccggagg gcaactggtg gagccagggg ctccatcgtg ttcgccgctc
      541 cctaaatagc ttcttcggct ccgacgacga tgatcaggaa aaggaacgtg agcgtcagag
      601 gcaaaggcaa aataatcgcg atgccgccaa ccggcaaaag gaacttcggc gccagcaaaa
      661 ggagagccag aaccgcgaga agcagctgcg attggagcgc caggagaggc agcgccttgc
      721 caagcggaac aatcacgtgg tcttcaatcg cgtcaccgat ccccgcaagc gggcatccga
      781 cctttacgac gagaacgagg catctggcct aaacgaggag gaaaccacca cctatcgcac
      841 ctactttgtt gttaatgagc catattcaga cgactacaag gagcgggaca gcctccagtt
      901 ccagaatctg caaaaacttc ttgacgagga cctgcgcaac ttcttcaatc gcaatttcga
      961 aaataacgat gatgaagagc aggaaatcca tagcacccta gagcgagtcg atcaaaccaa
     1021 ggaccatttt aaaattcgcg tgcaacttag ggtagatctg cccagttcaa tcaacgactt
     1081 tggaagtaag ttggagcaac aactgaatgt ctacaagcga atcgatcgtt tgggtgccag
     1141 taccgatggc gtcttcacct ttaccgaatc gagcgaattc gatgaggatc ctatcgaagt
     1201 tgcattgccc acggatgagg tggagggctc cggccaagat tccggtagct gtcgcggcga
     1261 tgccaccttc cagtgtcgaa ggagtggaaa gactatttgc gatgaaatgc gatgcgatgg
     1321 atctcgcgat tgtcccgatg ccgaggacga ggaaggctgc gaggtttgca acgaacttca
     1381 gttcaagtgc gataacaagt gtctgccgct caataagcgc tgcgataatc gatacgattg
     1441 tgaggatcag acggacgagg ctggttgtca acggtacgaa gtagaagagt ctcagcctca
     1501 gccgcagccg caacctcagc ctgaaccgga acctgaacct gaacctgagc ctgagcctga
     1561 acctgaacca gaaccagaac ctgaagagcc tataacagac aatgaacagc ctgagcaaaa
     1621 ctcagaatgc cgggccaccg agttcagatg caacaatggg gactgcatcg atattagaaa
     1681 gcgttgcgat cacatttcgg actgtagcga aggcgaggac gagaacgagg agtgccccgc
     1741 cgcctgcagc ggaatggagt atcaatgtcg cgacggcacg cgctgcataa gtttgagtca
     1801 gcagtgcgac ggtcattccg attgcagcga cgccgacgac gaggagcatt gcgacggaag
     1861 tggtaacgat ggtgaggatt gtcggttcga tgagttccgt tgcggaactg gtgagtgcat
     1921 accgatgcgt caggtgtgcg ataacatcta cgattgcaac gattattccg atgaggtcag
     1981 ctgcgccgag gaggaggaag atagtgtggg catacccatt ggccgtccac cgcagaggcc
     2041 agcgcccaaa cacgactggc tggacgaatt ggacgccaat gagtaccacg tctatcatcc
     2101 aagtaatgtc tatgagttgg ccaattccaa gaatccctgt gccagcaatc aatttcgctg
     2161 cgccaccacg aatgtgtgca tccccctgca tttgcgttgc gataatttct atcactgcaa
     2221 cgatatgagc gatgagaagg actgcgagca gtatcaacga cgcaccacca ccaccacccg
     2281 acgaccttcg acctcggccc ggccctcctt caccttcacc ttcacgaccc aggggccagg
     2341 cttgctggag cgtcgcaata gcaccaccag tagaaccacc gcaggcagca ccaccagagc
     2401 caccgaagca ccacaatggc catgggcaac cagacccacc gagaccacga ccactaaccc
     2461 aataacaaca gttggcgtag cgagcagctc acctcagtcc tcctgtctcg aaaacatcga
     2521 attcgcgtgt cacaatcgcg attgcattcc gattgagagc gtctgcgatg gcacccccga
     2581 ctgcggacgc agtgaagacg aggacgacgc tctttgcaag tgcaccgccg acaagtacaa
     2641 atgccaacac ggcggaggct gcattccgaa aacccaggtg tgcgatggca aacctcagtg
     2701 ccgcgaccgc agcgacgaga gcgcctgcca tctcaatgga agattaaata agactcgttt
     2761 gggggtccag tgccaggaaa accagtatca atgtggcgat ggaagctgca tctccggcta
     2821 caaacgctgc aatggcatca acgattgcgc cgatgacgcc gacgaatata actgcatcta
     2881 cacctacaac gaagactacg tagacccgga cgacaatcca ttgaatgaat gtgatatcct
     2941 tgagtttgaa tgtgactaca gtctgtgttt accgctagag aagaaatgcg atggctatgc
     3001 agactgtgaa gacttgagcg acgagttcga gtgtcagtcg tacacagaga attgtctatt
     3061 gtctgagttc gaatgcgatg gctactgcct gccccgcgat cagttatgca acggaataat
     3121 caattgccaa gatggcagcg acgagcgcaa ctgtaccttt tgccgggaag atgcctacct
     3181 ctgcaccacc ggcgagtgtg tggccgtaaa tcagagatgc aacggcatcg tcgaatgcgc
     3241 cgatggcagc gacgagcgtc actgcgtagt caacaccaca gagaccaact accattatcc
     3301 cacacacaat cctaaaccaa aaacctgccg aacccacgag tggcagtgta cgaatctcga
     3361 gtgcatcgag atgagattga agtgcgatga tgttccggat tgctcggatg gatccgatga
     3421 ggacctcagc atttgcttcg gcacggccac cacacgacta aagcccagcg actgcggtcc
     3481 ggatcagttc ttctgcgatg atttatgcta taatcgctct attcgatgca atggccatat
     3541 ggattgctca gatggcagtg atgagatcgc ttgtagctcg ctgtcagtgc ttccatgtcc
     3601 acagcaccag tgtcccagtg gcaggtgtta ttcggaaagt gagcgatgcg atcgccacag
     3661 gcactgcgag gatggctccg atgaggccaa ctgctgttac gcggatcaat tccgctgcaa
     3721 taatggtgac tgcattgcgg aatcggctca ttgcgatgga aatatcgatt gtagcgacca
     3781 gtccgatgaa ctcgactgcg gaggagactc gcagtgtctg cccaaccaat tccgctgcaa
     3841 gaatggccaa tgtgtgagct ctacagcgcg ttgcaacaag cgttccgatt gtttggatgg
     3901 ctccgatgag cagaattgtg ccaatgaacc taacaactcc ggacgtggaa cgaaccaatt
     3961 gaaactcaag acctatcccg acaaccaaat cattaaggag agtcgtgagg tcatcttccg
     4021 ttgccgtgac gaaggtccca accgcgccaa ggtcaagtgg tcgcgacccg gcggacgtcc
     4081 cctgcccccc ggtttcaccg atcgcaatgg ccgcctggag atccccaaca tcagggtgga
     4141 ggatgctggc gcctatgtct gcgaggccgt gggctatgcc aactatattc ccggtcagca
     4201 cgtcaccgta aacctcaacg tcgagcgctt aaacgaacgc gaaatccgtc cggactcagc
     4261 ctgtacggag taccaggcca cctgcatgaa cggcgagtgt atcgataagt cgggcatctg
     4321 cgatggacat ccggactgtt cggatggctc cgatgagcac agctgcagtt tgggtttgaa
     4381 gtgtcagccc aaccagttca tgtgctccaa ttccaagtgt gtggatcgca cctggcgctg
     4441 tgatggcgag aacgactgcg gcgataactc cgatgagacc tcttgcgatc cggaaccaag
     4501 tgatgctccg tgccgatacg acgaattcca gtgccgcagc ggtcattgca ttcccaagag
     4561 cttccagtgc gactatatga acgattgtac cgatggtacc gatgaaattg gatgctcggt
     4621 gccctctcca atgaccctac ccgcaccctc gattgtcgtg atggagtacg aggtcctcga
     4681 gctgacctgc gtgggcaccg gcgtcccgac gccgacgatc gtgtggcgtc tcaactgggg
     4741 ccatgtgccc gagaagtgtg aatcgaagag ctacggcgga accggaaccc tgcgctgtcc
     4801 gaacatgagg ccccaggaca gtggtgccta ctcgtgcgag ttcatcaaca cacgcggcac
     4861 cttctatccg aaaacgaact cgattgtcac cgttacgccg gtgcgctcgg atgtctgcaa
     4921 ggccggattc ttcaatatgc tggcccgcaa gtcggaggaa tgcgtccagt gcttctgctt
     4981 tggcgtttcg accaactgtg acagtgccaa tttgttcacc tacgccattc agccaccgat
     5041 cctttcgcac cgcgtggtca gcgttgaact cagtccgttc cgtcaaattg tcatcaatga
     5101 ggctagtccg ggtcaggatc tgctcacctt gcaccatggt gttcagttca gggcatcgaa
     5161 cgtacactac aacggccggg agacaccatt cttggccctg cccgctgagt atatgggcaa
     5221 ccagctgaag tcctatggcg gcaatctgcg ctacgaggtc aggtacaatg gcaacggtag
     5281 accggtcagc ggacccgatg tcatcatcac cggcaacagt ttcacgctaa cccatcgcgt
     5341 tcgcactcat ccgggtcaga acaacagggt gactattccc ttcctgccgg gaggctggac
     5401 gaagccggat ggtcgcaagg gaacgcgaga ggacatcatg atgatactgg ccaatgtgga
     5461 caatattctg attcgactgg gctacctgga tagcacagct cgcgaagtgg atctgataaa
     5521 tatcgccttg gattcggccg gaagtgccga tcagggattg ggcagtgcct cgctcgtgga
     5581 gaagtgcacc tgtccgcccg gctatgttgg tgattcgtgc gagtcctgtg cctcgggcta
     5641 tgttcgccag gcccgcggac cttggctggg tcattgtgtg cccttcaccc cggaaccgtg
     5701 cccagcggga acctacggca atccccgact tggtgttccc tgccaggagt gtccgtgccc
     5761 ccacgcgggc gccaataact ttgccagcgg ctgccaacag agtcccgatg gcgatgtgat
     5821 ttgccgctgc aacgaaggct atgccggcaa gaggtgcgag cactgcgccc agggttacca
     5881 gggtaatccg ttggcaccgg gaggagtctg tcgcaagata cccgatagtt cgtgcaatgt
     5941 cgacggcacc tacaacatct acagcaatgg aacgtgccag tgcaaggata gcgtgattgg
     6001 cgaacagtgc gacacctgcg cgccgaagag tttccacctc aattcgttca cctacaccgg
     6061 ttgcatcgag tgcttctgca gtggagtggg cttggattgt gacagtagtt cgtggtatcg
     6121 caaccaggtc accagcacct ttggacgaac gcgcgtcaat catggattcg ccctgattag
     6181 cgactatatg cgcaataccc cggtaacggt gcccgtttcc atgtccaccc aggccaatgc
     6241 cttgagcttc gtgggatccg ccgagcaggc cggtaatacg ctctactgga gtcttcccgc
     6301 cgccttcctg ggcaacaagc tgacctcgta cggaggcaag ttgagctaca cgctcagcta
     6361 cagtcccctg cccagcggca ttatgtcgcg caacagtgcc cccgatgtgg tgatcaagag
     6421 cggcgaggat ctgaggctca tccattacag gaagtcgcag gtcagtccca gtgtggccaa
     6481 cacctatgcc gtggagatca aggagagcgc atggcagcgc ggcgatgaac tggtgcctaa
     6541 ccgtgaacac gtcctgatgg ccctcagcaa tattacggcc atctatatca aggccacgta
     6601 cacgactagc accaaggagg cctcgctgcg atcggtcaca ttggatacgg ccacggccac
     6661 caatctgggc accgcacgtg ccgtcgaagt ggagcagtgc cgctgtcccg agggctattt
     6721 gggtctctcc tgcgagcagt gtgctcctgg ctatacgcgc gatccggagg caggaatcta
     6781 tctgggtctc tgcaggccct gcgagtgcaa tggacattcc aagtattgca acagtgagac
     6841 aggcgaatgc gaaagctgtt ccgacaacac cgaaggattc aattgtgacc gatgcgccgc
     6901 cggctatgtg ggtgatgcca cccgaggaac ttcgtacgac tgtcaatacg atgacggcgg
     6961 ctatccgacg tcgcgtccac cggcaccggg caatcagacg gccgaatgcc tggtgaattg
     7021 ccaacaggag ggaaccgccg gttgccgcgg ctaccagtgc gagtgcaaga ggaatgtggc
     7081 tggcgatcga tgcgatcagt gccgccccgg aacctatgga ctgtcggccc aaaatccgga
     7141 cggttgcaag gagtgctact gctccggact gaccaaccag tgccgctcgg cgtctctcta
     7201 ccgccagctg atacccgtgg acttcatttc gacgccacca ttgataacag acgaattcgg
     7261 cgacatcatg gatagggata accttgtgcc cgacgtgccc aggaatgtgt atacctacaa
     7321 gcacacctcc tacacgccca agtactggag cctgaggggt agtgtgctgg gcaaccagct
     7381 gttgtcgtac ggcggccgct tggagtacag cctgattgtg gagtccgttg gccgggacca
     7441 tcgtggcaag gatgtggtcc taattggcaa cggactcaag ctgatctggt cgcgacccga
     7501 tggccatgac aacgagcagg aataccatgt gcgtttgcat gaggacgagc agtggacggt
     7561 tgaggatcgt ggatcggcac gacaggccac gcgggccgac ttcatgactg tgctgtcgga
     7621 tctgcagcac atcctgatcc tggccacacc caaggtgccc acggtcagca cctcgattag
     7681 caatgtcatc ctggagagtt cgataaccac gagagcgcct ggagctacgc atgcctccga
     7741 tatcgagttg tgccagtgtc catccggtta tacgggcact tcctgtgagt cctgcgcacc
     7801 actgcactac cgcgacgcct ctggacgctg cagtcagtgt ccttgcgacg cttccaacac
     7861 ggaatcctgc ggcttggtca gcggcggtaa cgtcgaatgc cagtgcaggc cacgctggag
     7921 gggtgatcgc tgccgggaaa ttgacacatc gcccattatc gaagaaccgc cccagatatg
     7981 tgatttaagc aggggattct gttgcagcgg ctttcagttc gatatcgcac cgaacgagac
     8041 aatctcgttt aatgacaccc tgcagatata taagggcaac agaatcatag gaaatatgac
     8101 caagctgcgc tacggctgtc catcgcgaga aactaacgaa ccgactccgg aaccggatac
     8161 cagtaccgat gatcccgtgc gcacccagat catagtgtcg attgccaggc cagagattac
     8221 cattctgccc gtgggtggat cgctgaccct cagctgtacc ggtcgaatgc gctggaccaa
     8281 tagcccagtg tttgtgaact ggtacaagca gggcagtcac ctgcccgagg gagtcgaggt
     8341 gcaaggcggt aatctgcagc tgttcaacct gcagatcagc gattctggaa tctacatctg
     8401 ccaggccgta agcaacgaga ccggccacag ctttacggac cacgtctcca tcaccgtttc
     8461 ccaggaggac caacgctcgc cggctcacat tgtggatttg cccaacgacg tgaccttcga
     8521 ggagtacgta agcaatgaga tcgtctgcga ggtggagggc aacccaccac ccactgtcac
     8581 ctggactcgc gtggatggcc atgcggacgc ccaaagtacg cgaacggaca acaatcggct
     8641 ggtcttcgat tcgccgagga aatcggacga gggtcgctat cgctgccagg cagagaatag
     8701 cctgagtcgg gaggagaagt acgtagtcgt gtatgtccgg agcaatcctc cccagccgcc
     8761 gccgcagcag gatcgtttgt acatcacacc gcaggaggtg aacggtgtgg ccggtgactc
     8821 cttccagttg tcctgccaat tcaccagcgc tgcctctctg cgctacgatt ggtcccacga
     8881 tggtcgctcc ctgtccgcgt cgtcaccccg aaatgttgtg gtccgcggaa atgtcctgga
     8941 agtccgcgat gccaacgttc gcgactccgg cacctacacc tgtgtggcct tcgacctgcg
     9001 cacccgacgc aacttcaccg agagcgcacg ggtctacatc gagcagccca acgagccggg
     9061 aatccttggc gacaagccgc atatcttgac cttggagcag aacatcataa ttgtgcaagg
     9121 cgaggacttg agcatcacat gtgaggcaag tggaacgccc tatccctcga ttaagtggac
     9181 caaggtgcag gagaatctgg ccgaaaatgt ccgcatcagt ggcaatgtgc tcaccatcta
     9241 cggaggccgc agtgagaatc gtggtcttta ctcctgcatc gccgagaact ctcacggcag
     9301 cgatcagtcc agcacaagca tcgatattga accccgggag cggccgagtc ttacgattga
     9361 tacggccacc caaaaggttt cggttggctc ccaggcgtcc ctttactgtg ccgcccaggg
     9421 cattcccgaa ccgaccgtcg agtgggttcg aacggatggt cagccactgt cgccgcgtca
     9481 caaggtccag gcacccggct atgttgtgat cgatgacatt gtgctcgatg atagcggtac
     9541 ctacgagtgc cgggcgagca acatagctgg ccaggtgagc ggcttggcca ccattaacgt
     9601 ccaggagcca actcttgtgc ggatcgaacc agataggcaa caccatatcg tcacccaggg
     9661 cgacgaactc tcgctcagct gcgtgggcag tggcgtccct actccttcgg tcttttggag
     9721 tttcgaggga agagacgttg acaggatggg agtaccggaa ggtgctgttt ttgcgcaacc
     9781 tttccgaacc aacactgccg acgtgaaaat cttccgggtg agcaaggaga acgaaggcat
     9841 ctacgtctgt cacggatcca atgacgcggg tgaagatcaa caatacattc gcgtggaggt
     9901 acaacccaga cggggtgacg tcggtgcagg aggagatgac aatggtgatg tcgatacccg
     9961 acagcccccc aatcggcccc aaatccaacc gaatccattg agcaacgaac gcctgaccac
    10021 cgaattgggc aacaatgtga ccctcatctg caacgtggac aacgtgaaca cggaatggga
    10081 acgcgtcgat ggcacacccc tgccgcacaa tgcctacacg gtgagaaata cgctggtgat
    10141 tgtcttcgtg gagccgcaga atctgggtca gtaccgctgc aatggaatcg gtcgcgatgg
    10201 acgtgtggag gcccatgtgg tgagggagct ggttctcctg cccctgccca ggatcacctt
    10261 ctatcccaac atcccgctga ccgtggagct gggccagaac ttggatgtct actgccaggt
    10321 ggagaacgtg cgtccggagg acgtgcattg gaccaccgac aacaatcgac cactgcccag
    10381 ttccgtacgc atcgagggca atgtcctcag gttcgcgtcc atcactcagg ctgctgccgg
    10441 tgaataccgc tgctcggcca ccaatcaata tggaagccga tcgaagaacg ccagggtggt
    10501 ggtgaaacag cccagtggct tccagcccgt tccccactcg caggtgcaac agcgtcaggt
    10561 gggcgactcc atccagttgc gatgccgcct gaccacccag tacggcgacg aggttcgcgg
    10621 caatatccag ttcaactggt accgtgagga cggcagcccc ttgccccgcg gtgtccgtcc
    10681 ggatagccag gtgctgcagc tggttaaatt gcagcccgag gacgagggcc gctacatctg
    10741 caactcgtac gatttgggca gcgggcagca actgcccccc gtctccatcg acttgcaagt
    10801 actaagaact actacccagt atcctttcaa tcggtttaag ggcggtgtct ccctgaaaga
    10861 cacgccctgc atggttctgt atatttgtgc agcggtacca gcggctcccc agaaccccat
    10921 ctacctgccg ccagtggcgc caccacgttc gcccgaaagg atcctcgagc cccaactgag
    10981 cctgagtgta caatcctcga acctgccagc cggcgacggc accaccgtcg agtgcttctc
    11041 ctccgatgac tcctacccag atgtcgtgtg ggaacgcgcc gatggagctc cactcagcga
    11101 aaatgtccag caagtgggca ataacctggt gattagtaac gtggcctcca ccgatgccgg
    11161 taactatgtg tgcaagtgca agacggacga gggagatctg tataccacca gctacaaact
    11221 ggaggtcgag gagcagcccc atgaactgaa gagctccaag atagtctacg ccaaggttgg
    11281 cggaaatgcc gacttgcagt gcggagccga tgaagatcga cagcccagct accgttggtc
    11341 tcgccaatac ggacaacttc aggcgggacg cagtctgcag aatgagaaac tttcgttgga
    11401 tcgcgttcag gccaacgatg ccggaactta tgtttgttcg gcccaataca gcgatggcga
    11461 gacggttgac ttccccaaca ttctggttgt gaccggggcg attccccagt tccgccagga
    11521 gccccgcagc tacatgagct tccccacgct ctcgaactcc tcgttcaagt tcaacttcga
    11581 gctgaccttc cggccggaaa acgccgacgg actgctgctc ttcaatggac agacccgcgg
    11641 aagcggtgac tatatcgcac tctcgctgaa ggatcgctat gcggagttcc ggttcgattt
    11701 tggcggtaaa ccgttgctgg tgcgagcgga ggagccactg gctttggatg aatggcacac
    11761 ggtgcgcgtg agtcgcttca agcgggatgg ctacatccag gtggacgacc agcatccggt
    11821 ggccttcccc acctcccagc atcagcagat accccagttg gaactgattg aggatctgta
    11881 cattggcggc gtgcccaact gggagttcct gcccgccgag gcggtgggtc agcaatcagg
    11941 cttcgtgggc tgcattagcc ggctgaccct gcagggacgc accgtggagc tgatccggga
    12001 ggccaagttc aaggagggca tcaccgattg ccggccctgc gcccagggac cctgccagaa
    12061 caagggcgtc tgcctggaga gccagacgga gcaggcctac acctgcgtct gccagccggg
    12121 ctggactggc cgggattgtg ccatcgaggg cacccagtgc accgcaggag tttgcggctc
    12181 gggacgctgc gagaatacgg agaacgacat ggagtgcctg tgcccgctga acagggcagg
    12241 cgatcgatgc cagtacaatg agattctaaa tgaacagagc ttgaatttca agagcaacag
    12301 ctttgcggcc tacggaactc ccaaggtcac caaagtaaac atcacactct ccgttcgtcc
    12361 cgcgagcctg gaggactctg tgatcctgta cacggcggaa tccactctgc ccagcggcga
    12421 ttacctggct ttggtccttc gcggtggcca cgcggagctg ctgatcaaca cggccgcccg
    12481 cttggatccc gtggtggtgc gttcggcgga accgctgccc ctcaatcgct ggaccagaat
    12541 cgagatcagg cgtcgcctgg gcgagggaat cctcaaggtg ggcgatggac ccgagcgaaa
    12601 ggccaaggca ccgggatccg atcgcattct gtcgctcaag acccacctct ttgtgggcgg
    12661 cgtcgatcgg tcgaccgtaa agatcaaccg tgatgtgaac atcaccaagg gcttcgatgg
    12721 ctgcatctcg aagctgtaca actcgcagaa atccgtcaat ctgctgggtg acatcaggga
    12781 tgcggcgaat gtccagaact gtggggaggc gaatgagata gatgacgatg agtatgagat
    12841 gccagtagcg ctgccatcgc ctaaggtcgc cgagaatgaa cgtcagctga tggcgccgtg
    12901 tgccagtgat ccctgcgaga acgggggaag ctgcagcgag caggaggaca tggccatctg
    12961 ctcctgtccc ttcggcttca gcggcaaaca ctgccagaat cacctccagc tgagcttcaa
    13021 tgcctcgttc cgcggcgatg gctacgtgga gctgaaccgc agccacttcc aacccgccct
    13081 ggagcagacg tactcccaca ttggcattgt gttcaccacc aacaagccga atggcctgct
    13141 tttctggtgg ggccaggagg ccggggagga gtacaccgga caggacttca ttgccgccgc
    13201 cgtggtcgat ggctatgtgg agtactcgat gaggctcgat ggcgaggagg cggtcattcg
    13261 gaacagcgat atccgcgtgg acaatggcga gcggcacatt gtgatcgcca agcgggatga
    13321 gaacaccgcc atgctggaac tcgatcagat cctggacacg ggcgatacgc gacccaccat
    13381 caacaaggca atgaagctgc cgggcaatgt gtttgtcggt ggcgctcctg atgtcgcggc
    13441 attcacgggc ttccgctaca aggacaattt caacggctgc attgtggtcg tcgagggcga
    13501 aaccgtgggc caaattaacc ttagttcagc tgccatcaat ggagtgaatg ccaacgtgtg
    13561 tcccgctaac gacgaacctc tgggaggaac cgaaccgcca gtcgtctgag gacacaacca
    13621 gcaaccgaaa ttagcttttt aattaaacat taacaaatga aacaaaaaga aaaacaattt
    13681 ttatatatac aacatatgaa taagccccaa gcaaacctac aaaaaattga atattatacg
    13741 acgaacagat aatataaaaa caaaaaaaga gagaaacgat cacttctact acaattgctt
    13801 cttcgatcct taagtctagg ttaaagattg tagcaagaaa acaagcgaat atcacaaaca
    13861 tttatttaac aagaacgcca tgcgagaagt gaaacgaaac agaaacaata atgcaattaa
    13921 tgcagataat acagataaag cctagaaccc taagaactaa ctaactaact cgaacaagaa
    13981 caacaacgca tactagccaa ctgcaaccac aacaaccaca atagtgaagg cattttaatt
    14041 ataattttag tctctagctt ataactatga ctacgactcg ttttttttgt gagcccagtg
    14101 taaaatgttg gaaatcggaa attggcccta cacacaaaca cacacaagtt attaattaaa
    14161 taccaattga taccatataa tgataaatga aatactatga atgcaactat tgtgaacgaa
    14221 cgaaaaccgt tgagtggata aaaagcataa gcagaagata tattaaaatg aaatcaacaa
    14281 ca