Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218414 1383 bp mRNA linear INV 09-DEC-2024 transcript variant X2, mRNA. ACCESSION XM_070218414 VERSION XM_070218414.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1383 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1383 /gene="Gr2a" /note="Gustatory receptor 2a; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:108058393" CDS 62..1246 /gene="Gr2a" /codon_start=1 /product="putative gustatory receptor 2a isoform X2" /protein_id="XP_070074515.1" /db_xref="GeneID:108058393" /translation="MDTLRALKPLHRVCQVCNLWPWRLVPPPDTEGVLLRRSRWLELY GWTVLTAASGFTAYGLFQESSVQVANSVADSESAISSIGHTVDFIQLVGMRVAHLAAL LEALWQRQVQREFFAELGEIDHQLAKALRVDVEAMRLQMRRQTTRRAVWMLWGYAVSQ ILILGAKLLAPGTSFPVYWICYLLPLLVCGLRYFQIFTATQIVRQRLEVLLVALQQLQ LQQKSSSEEEEESQSQSDVEEAAMEQLIAVRLVYQRVWALVALLNRCYGLSMLIQVGN DFLAITSNCYWMFLNFRQSAASPYDILQIVASAVWSAPHLGNVLVLSLLCDRTAQCAT RLALCLHQLLHQRLHFSAAGFFNVDCTLLYTIVGATTTYLIILIQFHMSESTMGGGSN GE" misc_feature 80..1213 /gene="Gr2a" /note="7tm Chemosensory receptor; Region: 7tm_7; pfam08395" /db_xref="CDD:462463" ORIGIN 1 ctaatatctc ctccatttcc agttgcagat accaaacacg aatcagatat aatagttggt 61 catggacacg ctgagagcgc tgaagccgct ccaccgcgtc tgccaggtgt gcaacctgtg 121 gccctggcgc ctcgtcccac cgcccgacac cgaaggcgtc ctcctccgcc gatcccgctg 181 gctggagctc tacggctgga cggttctaac ggctgccagc ggcttcaccg cttacggtct 241 cttccaggag agcagcgtcc aggtggcgaa ctccgtggcg gactccgagt cggctatctc 301 gagcattggt cacacggtgg acttcatcca gctggtgggc atgcgggtgg cccacctggc 361 cgccctgctg gaggccctgt ggcagcgtca ggtgcagcgc gagttcttcg ccgagctggg 421 cgagatcgat caccagctgg ccaaggcgct gcgcgtggac gtggaggcca tgcgcctcca 481 gatgcgtcgc cagacgacgc gccgcgccgt ttggatgctg tggggctatg ccgtcagcca 541 gatcctgatc ctcggagcca agctgctcgc cccgggcacc agcttccccg tctactggat 601 ctgctacctg ctgccgctgc tcgtctgcgg attgcgctac tttcagatct tcaccgccac 661 ccagattgtg cgccagcgcc tcgaagtgct ccttgtggcc ctgcagcagc tgcagctgca 721 gcagaagagc tcctcggagg aggaggagga atcacagtca caatccgatg tcgaagaggc 781 ggccatggag caactgattg ccgtgcggct cgtttaccaa cgggtctggg ctttagtggc 841 cctgctgaac cgctgctacg gcctctccat gctcatccag gtgggcaacg acttcctggc 901 catcacctcc aactgctact ggatgttcct caacttccgc cagtcggcgg cctcccccta 961 cgacatcctg cagatagtcg ccagtgccgt gtggtctgcc ccccacctgg gcaacgtgct 1021 cgtgctctcg cttctctgcg accgaacggc ccagtgtgcc actcgcctgg cactgtgcct 1081 gcaccagctg ctccaccagc ggctccactt cagcgccgct ggattcttca acgtggactg 1141 cacccttctc tacacgattg tgggcgccac cacaacatac ctcatcatcc tgatccagtt 1201 ccacatgagc gagtccacca tgggcggcgg atcgaatgga gagtagctgc tgcaacgtaa 1261 ccaaaccgca atttatgcac cgaatccaaa aagtattagt ttacatccaa aaaaagtcct 1321 tttgattgta taccttaata attataattt tttgcatgtc atgtgtataa aaagattaaa 1381 ttg