Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Gustatory receptor 2a (Gr2a),


LOCUS       XM_070218414            1383 bp    mRNA    linear   INV 09-DEC-2024
            transcript variant X2, mRNA.
ACCESSION   XM_070218414
VERSION     XM_070218414.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1383
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1383
                     /gene="Gr2a"
                     /note="Gustatory receptor 2a; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:108058393"
     CDS             62..1246
                     /gene="Gr2a"
                     /codon_start=1
                     /product="putative gustatory receptor 2a isoform X2"
                     /protein_id="XP_070074515.1"
                     /db_xref="GeneID:108058393"
                     /translation="MDTLRALKPLHRVCQVCNLWPWRLVPPPDTEGVLLRRSRWLELY
                     GWTVLTAASGFTAYGLFQESSVQVANSVADSESAISSIGHTVDFIQLVGMRVAHLAAL
                     LEALWQRQVQREFFAELGEIDHQLAKALRVDVEAMRLQMRRQTTRRAVWMLWGYAVSQ
                     ILILGAKLLAPGTSFPVYWICYLLPLLVCGLRYFQIFTATQIVRQRLEVLLVALQQLQ
                     LQQKSSSEEEEESQSQSDVEEAAMEQLIAVRLVYQRVWALVALLNRCYGLSMLIQVGN
                     DFLAITSNCYWMFLNFRQSAASPYDILQIVASAVWSAPHLGNVLVLSLLCDRTAQCAT
                     RLALCLHQLLHQRLHFSAAGFFNVDCTLLYTIVGATTTYLIILIQFHMSESTMGGGSN
                     GE"
     misc_feature    80..1213
                     /gene="Gr2a"
                     /note="7tm Chemosensory receptor; Region: 7tm_7;
                     pfam08395"
                     /db_xref="CDD:462463"
ORIGIN      
        1 ctaatatctc ctccatttcc agttgcagat accaaacacg aatcagatat aatagttggt
       61 catggacacg ctgagagcgc tgaagccgct ccaccgcgtc tgccaggtgt gcaacctgtg
      121 gccctggcgc ctcgtcccac cgcccgacac cgaaggcgtc ctcctccgcc gatcccgctg
      181 gctggagctc tacggctgga cggttctaac ggctgccagc ggcttcaccg cttacggtct
      241 cttccaggag agcagcgtcc aggtggcgaa ctccgtggcg gactccgagt cggctatctc
      301 gagcattggt cacacggtgg acttcatcca gctggtgggc atgcgggtgg cccacctggc
      361 cgccctgctg gaggccctgt ggcagcgtca ggtgcagcgc gagttcttcg ccgagctggg
      421 cgagatcgat caccagctgg ccaaggcgct gcgcgtggac gtggaggcca tgcgcctcca
      481 gatgcgtcgc cagacgacgc gccgcgccgt ttggatgctg tggggctatg ccgtcagcca
      541 gatcctgatc ctcggagcca agctgctcgc cccgggcacc agcttccccg tctactggat
      601 ctgctacctg ctgccgctgc tcgtctgcgg attgcgctac tttcagatct tcaccgccac
      661 ccagattgtg cgccagcgcc tcgaagtgct ccttgtggcc ctgcagcagc tgcagctgca
      721 gcagaagagc tcctcggagg aggaggagga atcacagtca caatccgatg tcgaagaggc
      781 ggccatggag caactgattg ccgtgcggct cgtttaccaa cgggtctggg ctttagtggc
      841 cctgctgaac cgctgctacg gcctctccat gctcatccag gtgggcaacg acttcctggc
      901 catcacctcc aactgctact ggatgttcct caacttccgc cagtcggcgg cctcccccta
      961 cgacatcctg cagatagtcg ccagtgccgt gtggtctgcc ccccacctgg gcaacgtgct
     1021 cgtgctctcg cttctctgcg accgaacggc ccagtgtgcc actcgcctgg cactgtgcct
     1081 gcaccagctg ctccaccagc ggctccactt cagcgccgct ggattcttca acgtggactg
     1141 cacccttctc tacacgattg tgggcgccac cacaacatac ctcatcatcc tgatccagtt
     1201 ccacatgagc gagtccacca tgggcggcgg atcgaatgga gagtagctgc tgcaacgtaa
     1261 ccaaaccgca atttatgcac cgaatccaaa aagtattagt ttacatccaa aaaaagtcct
     1321 tttgattgta taccttaata attataattt tttgcatgtc atgtgtataa aaagattaaa
     1381 ttg