Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Glutathione synthetase 2 (Gss2),


LOCUS       XM_070218393             943 bp    mRNA    linear   INV 09-DEC-2024
            transcript variant X5, mRNA.
ACCESSION   XM_070218393
VERSION     XM_070218393.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..943
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..943
                     /gene="Gss2"
                     /note="Glutathione synthetase 2; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:108066934"
     CDS             387..791
                     /gene="Gss2"
                     /codon_start=1
                     /product="glutathione synthetase isoform X3"
                     /protein_id="XP_070074494.1"
                     /db_xref="GeneID:108066934"
                     /translation="MSSDATTPVLRNCIRLPLPEDELLEVTAKAKDYAIMHGAAMRSK
                     TAFSQDSLNFAPFVLVPSSFPRKEFEKAVALQPIINRLMHNVAHDEEFITTTLAETIK
                     VDEFTANLFNIYRKVLAHGFTQICTQRTGTCG"
     misc_feature    444..>758
                     /gene="Gss2"
                     /note="Eukaryotic glutathione synthase, ATP binding
                     domain; Region: GSH_synth_ATP; pfam03917"
                     /db_xref="CDD:461091"
ORIGIN      
        1 taggcccgat atcgatagca gtcttgtttt tgtacaaaat attttatttt attttcgatt
       61 cgattcgttt tttgggtttt tggccgattt ctaaattgag aacgcagcgc aaagcgattc
      121 ggtgtccaaa ttgccagtgc atcgagccaa aagagaggag tgtcagccag ggaaaccagg
      181 gaaatcaggg aaaccaaggc aaccagcgcg gaaagccaca acaatcggtg gcgaaatcgg
      241 gagatagcag ctatattcca attccagcac tccagtggtg agtagtgctc agtgcccagc
      301 gagcagttcc ggcgagcaga cccacgcagc tgatccgaag atcccagatc ccagaccccc
      361 gaatcccgcc cagagccacc ctaatcatgt ccagcgacgc caccacgcca gtgctgcgca
      421 actgcatccg gctgccgctg ccggaggacg agctgctgga ggtgacggcg aaggccaagg
      481 actatgccat catgcacggc gccgccatgc gatcgaagac cgccttcagc caggactcgc
      541 tcaattttgc cccctttgtc ctggtgccct cctcgtttcc gcgcaaggag ttcgaaaagg
      601 cggtggccct gcagccgata atcaaccggc tgatgcacaa cgtggcccac gacgaggagt
      661 tcatcacgac gacgctggcg gagacgatca aggtggacga gttcacggcc aatctgttca
      721 acatctaccg caaggtgctg gcgcacgggt tcacccagat ttgtactcag cgaactggga
      781 catgcggata agttgcacaa tatgcccaat aataatgccc tggccggact ttgcgatggg
      841 atggtcaagg cgtgggacat ctacgccaag ccgaaggctg tgatcctgtt catcatcgag
      901 gatgtgtcgt ataacatctg cgaccagcgc ttccacgagt tct