Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218393 943 bp mRNA linear INV 09-DEC-2024 transcript variant X5, mRNA. ACCESSION XM_070218393 VERSION XM_070218393.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..943 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..943 /gene="Gss2" /note="Glutathione synthetase 2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108066934" CDS 387..791 /gene="Gss2" /codon_start=1 /product="glutathione synthetase isoform X3" /protein_id="XP_070074494.1" /db_xref="GeneID:108066934" /translation="MSSDATTPVLRNCIRLPLPEDELLEVTAKAKDYAIMHGAAMRSK TAFSQDSLNFAPFVLVPSSFPRKEFEKAVALQPIINRLMHNVAHDEEFITTTLAETIK VDEFTANLFNIYRKVLAHGFTQICTQRTGTCG" misc_feature 444..>758 /gene="Gss2" /note="Eukaryotic glutathione synthase, ATP binding domain; Region: GSH_synth_ATP; pfam03917" /db_xref="CDD:461091" ORIGIN 1 taggcccgat atcgatagca gtcttgtttt tgtacaaaat attttatttt attttcgatt 61 cgattcgttt tttgggtttt tggccgattt ctaaattgag aacgcagcgc aaagcgattc 121 ggtgtccaaa ttgccagtgc atcgagccaa aagagaggag tgtcagccag ggaaaccagg 181 gaaatcaggg aaaccaaggc aaccagcgcg gaaagccaca acaatcggtg gcgaaatcgg 241 gagatagcag ctatattcca attccagcac tccagtggtg agtagtgctc agtgcccagc 301 gagcagttcc ggcgagcaga cccacgcagc tgatccgaag atcccagatc ccagaccccc 361 gaatcccgcc cagagccacc ctaatcatgt ccagcgacgc caccacgcca gtgctgcgca 421 actgcatccg gctgccgctg ccggaggacg agctgctgga ggtgacggcg aaggccaagg 481 actatgccat catgcacggc gccgccatgc gatcgaagac cgccttcagc caggactcgc 541 tcaattttgc cccctttgtc ctggtgccct cctcgtttcc gcgcaaggag ttcgaaaagg 601 cggtggccct gcagccgata atcaaccggc tgatgcacaa cgtggcccac gacgaggagt 661 tcatcacgac gacgctggcg gagacgatca aggtggacga gttcacggcc aatctgttca 721 acatctaccg caaggtgctg gcgcacgggt tcacccagat ttgtactcag cgaactggga 781 catgcggata agttgcacaa tatgcccaat aataatgccc tggccggact ttgcgatggg 841 atggtcaagg cgtgggacat ctacgccaag ccgaaggctg tgatcctgtt catcatcgag 901 gatgtgtcgt ataacatctg cgaccagcgc ttccacgagt tct