Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218365 495 bp mRNA linear INV 09-DEC-2024 transcript variant X2, mRNA. ACCESSION XM_070218365 VERSION XM_070218365.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..495 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..495 /gene="Pa1" /note="PTIP associated 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108066928" CDS 88..462 /gene="Pa1" /codon_start=1 /product="uncharacterized protein Pa1" /protein_id="XP_070074466.1" /db_xref="GeneID:108066928" /translation="MATDVEPAANTADKFSANAEELEGYYLQLDAGGIPELQWQFPGR RAPSPEASGGSGGNSKELEPLNDAIEQEPQKANDFDFSDEVAPTQMRVRSQTSTPKSA KKKTANFAGVMETLKKKNAESS" misc_feature 139..441 /gene="Pa1" /note="PAXIP1-associated-protein-1 C term PTIP binding protein; Region: PAXIP1_C; pfam15364" /db_xref="CDD:464674" ORIGIN 1 tgcccataaa tcgtatacaa aaaccaagaa attccctaaa actgtaacaa attaaggatt 61 taattaaact tatagactaa atccgcgatg gcaaccgacg tggagccggc ggcgaacacg 121 gcggacaagt tttcggctaa tgccgaggag ctggagggct actatcttca actggacgcg 181 ggcggcattc cggagctcca gtggcaattc ccgggacgca gggctccctc gccggaggct 241 tcgggcggat cgggtggcaa cagcaaggag ctggagcccc tgaacgatgc catcgaacag 301 gaaccccaga aggccaacga cttcgacttc agcgacgagg tggcccccac ccagatgcgc 361 gtccgcagcc agacctccac gcccaagtcg gccaagaaga agacggccaa cttcgcgggc 421 gtcatggaga cgctgaagaa gaagaacgcc gagagctcct agcacccgcc aaagttttga 481 tctagcctaa gatca