Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_070218358            1434 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108054077), mRNA.
ACCESSION   XM_070218358
VERSION     XM_070218358.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1434
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1434
                     /gene="LOC108054077"
                     /note="uncharacterized LOC108054077; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108054077"
     CDS             47..1234
                     /gene="LOC108054077"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_070074459.1"
                     /db_xref="GeneID:108054077"
                     /translation="MHLLFLLLLPCVPLGVPGEVLPLEPDLDNIQLSVRSANRGDKLQ
                     VFHSIWGAIRSDFAEDTDKVKGLYGQLGAFIRDEMQCSSGAAGRSACELQQEVRRHLR
                     TLMAQRLANQLNAEESLRTYGMYIAASVEPALVRDILVRAIEDVYFHRPADRLVQQLE
                     QIYADRDEVSFRMMIEAQLVLFWRYHSMQDDSEAFLFNMAHMVSKIRTHHMYASVDGS
                     LQKRVESVAKSLPAVLALLFHPQGFCLLSRSDREYIYTTITDEWNYGLNGRQVFAWHE
                     QNYTDSAGLIRAFVQEQQHSDGPPVFTLRSELFKWYFFVDPTQANRLGALRSGSPSSS
                     SSFWSIAYAGDALIFRQRDLTLCAAEKYDEERRLVKMLPGQMHTPPSEACQWLPIDCA
                     APK"
     polyA_site      1434
                     /gene="LOC108054077"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cccagcgcaa tcccactaat cagtaggcca acgatcctcc aacgagatgc acctgctgtt
       61 cctcctgctc ctcccctgcg ttccactggg cgttcctggc gaggttctgc ccctggaacc
      121 cgacttggac aacattcagt taagcgtgcg gagtgccaat cgcggagaca agctgcaggt
      181 cttccacagc atctgggggg ccattcgctc ggacttcgcc gaggacacgg acaaggtgaa
      241 gggcctctac ggccagctgg gcgccttcat ccgcgacgag atgcagtgca gcagcggggc
      301 cgccgggcgg tcggcctgcg agctgcagca ggaggtgcgc cgccacctga ggacgctgat
      361 ggcccagcgg ctggccaacc agctgaacgc cgaggagagc ctccggacgt acggcatgta
      421 catagcggcc agcgtggagc ccgctttggt cagggacatc ctggtgcgcg ccatcgagga
      481 cgtgtacttc catcggccgg cggacaggct ggtccagcag ctggagcaaa tctacgcgga
      541 tcgcgacgag gtgagcttcc gcatgatgat cgaggcgcag ctggtgctct tctggcgcta
      601 ccattccatg caggacgaca gcgaggcgtt cctgtttaac atggcgcaca tggtcagcaa
      661 gattaggacg catcacatgt acgccagcgt ggatggttcg ctgcagaagc gagtggagtc
      721 ggtggccaaa agtctgcccg ctgtgctggc gctgctcttc catccgcagg gcttctgttt
      781 gttgagtcgc tccgatcgcg agtacatcta cacgacgatc acggatgagt ggaactacgg
      841 gctcaacggc aggcaggtct tcgcctggca cgagcagaac tacaccgatt ccgcgggcct
      901 catccgcgcg tttgtccagg agcagcagca ctccgatgga ccgcctgtct tcacgctgcg
      961 cagcgagctc ttcaaatggt acttcttcgt ggatcccacg caggccaatc gactgggcgc
     1021 cctgcgctcg ggcagtccca gttcgtcgtc cagtttctgg agcatcgcct atgccggcga
     1081 cgccctcatc ttccggcagc gcgatctcac gctctgtgcg gccgagaagt acgacgagga
     1141 gcgcaggctg gtgaagatgc tgccgggtca gatgcacacg ccgccctcgg aggcctgtca
     1201 gtggctgccc atcgattgtg cggcgccaaa gtgaacggga tgggtggagt ccgtttttgc
     1261 ggggaaataa atacactcga tagtgtaaac ttacaaattt tcgttttcta gaaagaaatt
     1321 ttttgtctat ttttaatgga gagatttcta atattgtgtg tgagtgtact tacatgtttt
     1381 caatatattt accataaaat aaatacactc gatagtgtaa actgacaaac ttca